Result : P0DN74
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YtiA |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 4563668 |
| Right | 4563925 |
| Strand | - |
| Nucleotide Sequence | ATGAAAGAGTTTTTATTTTTATTTCACTCCACGGTCGGCGTCATACAAACCCGCAAAGCGTTGCAGGCAGCGGGCATGACTTTTCGCGTCAGCGATATTCCCCGTGATTTACGCGGCGGCTGCGGGTTATGCATTTGGCTGACCTGTCCCCCCGGCGAGGAAATACAATGGGTGATCCCTGGGCTGACTGAGTCAATTTATTGCCAGCAGGATGGTGTCTGGCGCTGCATTGCACATTACGGGGTTTCTCCGCGTTAA |
| Sequence | MKEFLFLFHSTVGVIQTRKALQAAGMTFRVSDIPRDLRGGCGLCIWLTCPPGEEIQWVIPGLTESIYCQQDGVWRCIAHYGVSPR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam11823. Profile Description: Protein of unknown function (DUF3343). This family of proteins are functionally uncharacterized. This protein is found in bacteria and archaea. Proteins in this family are typically between 78 to 102 amino acids in length. |
| Pubmed ID | 9278503 |
| Domain | CDD:403124 |
| Functional Category | Others |
| Uniprot ID | P0DN74 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 23
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4563668 | 4563925 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 3677295 | 3677552 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 4590311 | 4590574 | - | NZ_AP014857.1 | Escherichia albertii |
| 4 | 5426911 | 5427177 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 556782 | 557039 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 2158152 | 2158406 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 1281872 | 1282129 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 8 | 3225597 | 3225848 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 9 | 430827 | 431102 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 10 | 1691256 | 1691507 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 11 | 3776735 | 3776992 | + | NZ_CP023525.1 | Cedecea neteri |
| 12 | 5211095 | 5211352 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 13 | 4926476 | 4926724 | + | NZ_CP050508.1 | Raoultella terrigena |
| 14 | 3931092 | 3931334 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 15 | 1917829 | 1918080 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 16 | 5317149 | 5317355 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 17 | 2414597 | 2414851 | - | NZ_CP026047.1 | Raoultella planticola |
| 18 | 4577152 | 4577406 | + | NZ_CP041247.1 | Raoultella electrica |
| 19 | 2423923 | 2424159 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 20 | 4565217 | 4565471 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 21 | 4537601 | 4537855 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 22 | 4823563 | 4823817 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 23 | 651216 | 651470 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 24 | 2731355 | 2731612 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01869.22 | 0.91 | 21 | -3.0 | same-strand | BadF/BadG/BcrA/BcrD ATPase family |
| 2 | PF06050.15 | 0.91 | 21 | 774.0 | same-strand | 2-hydroxyglutaryl-CoA dehydratase, D-component |
| 3 | PF04286.14 | 0.65 | 15 | 2303.5 | same-strand | Protein of unknown function (DUF445) |
++ More..