Result : P0DKT0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Mycoredoxin 1 (EC 1.20.4.3) |
| NCBI Accession ID | HE802067.1 |
| Organism | Corynebacterium glutamicum (strain ATCC 13032 / K051) |
| Left | 897723 |
| Right | 897962 |
| Strand | - |
| Nucleotide Sequence | ATGAGCAACGTAACCATTTACGCCACAGATTGGTGCCCTTACTGCCGATCCCTCCTCAAAGGTCTCGACGGCCAAGAGTACGACCTCATCGACGTCGACCAAGATGAGGAAGCCGGCGAGTGGGTTAAGTCAGTCAACGACGGCAACCGCATCGTCCCAACCGTGCGCTACTCCGATGGCACCCACGCAACTAATCCCCTAGCTGCGGAAGTAATCGCCAAAATCGAAGCATTAGCCTAA |
| Sequence | MSNVTIYATDWCPYCRSLLKGLDGQEYDLIDVDQDEEAGEWVKSVNDGNRIVPTVRYSDGTHATNPLAAEVIAKIEALA |
| Source of smORF | Swiss-Prot |
| Function | Involved in defense against toxic arsenate. Involved in the mycothiol/myoredoxin redox pathway which uses a mycothioltransferase mechanism; functions as a monothiol mixed disulfide reductase and is recycled by a second mycothiol forming mycothione which in turn is reduced in a NADPH-dependent manner (By similarity). {ECO:0000250}. |
| Pubmed ID | 22640862 |
| Domain | CDD:412351 |
| Functional Category | Others |
| Uniprot ID | P0DKT0 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 73
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1054305 | 1054544 | - | NZ_AP017369.1 | Corynebacterium suranareeae |
| 2 | 880878 | 881117 | - | NZ_CP015622.1 | Corynebacterium crudilactis |
| 3 | 867626 | 867865 | - | NC_020506.1 | Corynebacterium callunae DSM 20147 |
| 4 | 873742 | 873978 | - | NZ_CP009220.1 | Corynebacterium deserti GIMN1.010 |
| 5 | 799104 | 799352 | - | NZ_CP006764.1 | Corynebacterium doosanense CAU 212 = DSM 45436 |
| 6 | 975800 | 976048 | - | NC_004369.1 | Corynebacterium efficiens YS-314 |
| 7 | 1832155 | 1832355 | + | NZ_CP011312.1 | Corynebacterium kutscheri |
| 8 | 679434 | 679685 | - | NZ_CP011546.1 | Corynebacterium uterequi |
| 9 | 656716 | 656988 | - | NZ_CP007790.1 | Corynebacterium marinum DSM 44953 |
| 10 | 888578 | 888817 | - | NC_020302.1 | Corynebacterium halotolerans YIM 70093 = DSM 44683 |
| 11 | 1757888 | 1758139 | + | NZ_CP026947.1 | Corynebacterium yudongzhengii |
| 12 | 1683710 | 1683967 | + | NZ_CP033898.1 | Corynebacterium pseudopelargi |
| 13 | 1684484 | 1684741 | + | NZ_CP035299.1 | Corynebacterium pelargi |
| 14 | 700151 | 700408 | - | NZ_CP033897.1 | Corynebacterium gerontici |
| 15 | 2739811 | 2740053 | + | NZ_CP006842.1 | Corynebacterium glyciniphilum AJ 3170 |
| 16 | 679461 | 679745 | - | NZ_CP009215.1 | Corynebacterium ureicelerivorans |
| 17 | 717994 | 718233 | - | NZ_LN831026.1 | Corynebacterium diphtheriae |
| 18 | 759509 | 759748 | - | NZ_LR738855.1 | Corynebacterium rouxii |
| 19 | 844657 | 844908 | - | NZ_CP009245.1 | Corynebacterium aquilae DSM 44791 |
| 20 | 488049 | 488288 | + | NC_022198.1 | Corynebacterium argentoratense DSM 44202 |
| 21 | 928631 | 928894 | - | NZ_CP004353.1 | Corynebacterium vitaeruminis DSM 20294 |
| 22 | 722130 | 722390 | - | NZ_CP011545.1 | Corynebacterium testudinoris |
| 23 | 768914 | 769162 | - | NZ_CP011541.1 | Corynebacterium epidermidicanis |
| 24 | 768924 | 769133 | - | NZ_CP039247.1 | Corynebacterium endometrii |
| 25 | 993551 | 993817 | - | NZ_CP011542.1 | Corynebacterium mustelae |
| 26 | 2210636 | 2210887 | - | NZ_LT906443.1 | Corynebacterium ulcerans |
| 27 | 667634 | 667888 | - | NC_017301.2 | Corynebacterium pseudotuberculosis C231 |
| 28 | 1430163 | 1430426 | + | NZ_CP042429.1 | Corynebacterium nuruki S6-4 |
| 29 | 593741 | 594007 | - | NZ_CP006841.1 | Corynebacterium lactis RW2-5 |
| 30 | 807011 | 807289 | - | NZ_LT906467.1 | Corynebacterium imitans |
| 31 | 1404586 | 1404819 | + | NZ_CP069485.1 | Corynebacterium glucuronolyticum |
| 32 | 837354 | 837599 | - | NC_021915.1 | Corynebacterium maris DSM 45190 |
| 33 | 1510093 | 1510335 | + | NZ_CP032788.1 | Corynebacterium xerosis |
| 34 | 725821 | 726075 | - | NZ_CP019688.1 | Corynebacterium glaucum |
| 35 | 1899861 | 1900142 | + | NZ_CP067012.1 | Corynebacterium kefirresidentii |
| 36 | 674922 | 675158 | - | NC_021663.1 | Corynebacterium terpenotabidum Y-11 |
| 37 | 916325 | 916531 | - | NZ_CP010827.1 | Corynebacterium singulare |
| 38 | 2242183 | 2242425 | - | NZ_CP068168.1 | Corynebacterium amycolatum |
| 39 | 2075340 | 2075549 | + | NZ_LR698967.1 | Corynebacterium ammoniagenes |
| 40 | 1999672 | 1999956 | + | NZ_CP009251.1 | Corynebacterium stationis |
| 41 | 765322 | 765603 | - | NZ_CP011311.1 | Corynebacterium camporealensis |
| 42 | 2010178 | 2010378 | + | NZ_CP009249.1 | Corynebacterium phocae |
| 43 | 140157 | 140414 | + | NZ_CP038157.1 | Corynebacterium sanguinis |
| 44 | 1581781 | 1582011 | - | NZ_AP023396.1 | Nocardia wallacei |
| 45 | 1332609 | 1332863 | - | NZ_AP018164.1 | Mycobacterium shigaense |
| 46 | 1086425 | 1086700 | - | NZ_CP015453.1 | Dietzia psychralcaliphila |
| 47 | 522329 | 522571 | - | NZ_CP009248.1 | Corynebacterium sphenisci DSM 44792 |
| 48 | 1701708 | 1701953 | + | NZ_LT906473.1 | Corynebacterium cystitidis |
| 49 | 3237760 | 3237990 | - | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 50 | 3288268 | 3288501 | - | NZ_CP047156.1 | Epidermidibacterium keratini |
| 51 | 5359300 | 5359494 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 52 | 692391 | 692633 | - | NZ_CP026948.1 | Corynebacterium liangguodongii |
| 53 | 4707786 | 4708022 | + | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 54 | 1638492 | 1638737 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 55 | 863890 | 864144 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 56 | 1142052 | 1142294 | - | NZ_CP015961.1 | Dietzia timorensis |
| 57 | 43883 | 44077 | - | NZ_AP022582.1 | Mycobacterium seoulense |
| 58 | 5106108 | 5106377 | + | NZ_CP015235.1 | Rhodococcus fascians D188 |
| 59 | 3535541 | 3535795 | + | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 60 | 3875750 | 3876004 | + | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 61 | 4290511 | 4290741 | - | NZ_LS483468.1 | Rhodococcus coprophilus |
| 62 | 3052099 | 3052362 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 63 | 3680262 | 3680486 | + | NZ_CP027793.1 | Rhodococcus hoagii |
| 64 | 3771870 | 3772094 | - | NC_016906.1 | Gordonia polyisoprenivorans VH2 |
| 65 | 2690006 | 2690236 | + | NZ_CP048813.1 | Rhodococcus triatomae |
| 66 | 2648218 | 2648472 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 67 | 3319274 | 3319528 | + | NZ_CP029146.1 | Rhodococcus ruber |
| 68 | 856461 | 856685 | - | NC_013530.1 | Xylanimonas cellulosilytica DSM 15894 |
| 69 | 903288 | 903512 | - | NC_015588.1 | Isoptericola variabilis 225 |
| 70 | 2345261 | 2345518 | - | NZ_AP023172.1 | Rhodococcus qingshengii |
| 71 | 3671306 | 3671530 | - | NZ_CP035495.1 | Xylanimonas allomyrinae |
| 72 | 1067663 | 1067884 | - | NC_015671.1 | Cellulomonas gilvus ATCC 13127 |
| 73 | 1146177 | 1146437 | - | NZ_CP015449.1 | Dietzia lutea |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP017369.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00303.21 | 0.6 | 44 | 542.0 | same-strand | Thymidylate synthase |
++ More..