Result : P0DF85
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable tautomerase SPs0996 (EC 5.3.2.-) |
| NCBI Accession ID | BA000034.2 |
| Organism | Streptococcus pyogenes serotype M3 (strain SSI-1) |
| Left | 980178 |
| Right | 980363 |
| Strand | - |
| Nucleotide Sequence | ATGCCATTTGTAACAATTGACTTGTTTGAGGGACGCTCACAAGAACAAAAAAATCAATTAGCTCGCGAGGTTACCGAAGTAGTCTCACGCATTGCAAAAGCACCTAAAGAAAATATCCATGTTTTTATCAACGATATGCCTGAAGGAACTTACTATCCTCAAGGTGAAATGAAACAAAAATCATAA |
| Sequence | MPFVTIDLFEGRSQEQKNQLAREVTEVVSRIAKAPKENIHVFINDMPEGTYYPQGEMKQKS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00235. Profile Description: N/A. This family includes the enzyme 4-oxalocrotonate tautomerase, which catalyzes the ketonisation of 2-hydroxymuconate to 2-oxo-3-hexenedioate. |
| Pubmed ID | 12799345 |
| Domain | CDD:412246 |
| Functional Category | Others |
| Uniprot ID | P0DF85 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 70
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 830937 | 831122 | - | NZ_CP010450.1 | Streptococcus pyogenes |
| 2 | 1070144 | 1070326 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 3 | 960579 | 960764 | - | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 4 | 185464 | 185649 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 5 | 1539083 | 1539271 | - | NZ_LR134293.1 | Streptococcus canis |
| 6 | 992178 | 992363 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 7 | 590494 | 590679 | - | NZ_CP013237.1 | Streptococcus mutans |
| 8 | 954746 | 954931 | - | NZ_AP014612.1 | Streptococcus troglodytae |
| 9 | 787914 | 788099 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
| 10 | 936045 | 936230 | + | NZ_LS483343.1 | Streptococcus ferus |
| 11 | 974318 | 974503 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 12 | 1873474 | 1873659 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 13 | 1800750 | 1800935 | + | NZ_CP043405.1 | Streptococcus ratti |
| 14 | 944552 | 944737 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 15 | 523220 | 523405 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 16 | 1016129 | 1016314 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 17 | 1088626 | 1088811 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 18 | 1036571 | 1036756 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 19 | 1042983 | 1043165 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 20 | 818927 | 819109 | - | NC_012924.1 | Streptococcus suis SC84 |
| 21 | 1215555 | 1215737 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 22 | 1976575 | 1976760 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 23 | 1506691 | 1506876 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 24 | 930786 | 930968 | - | NZ_CP014699.1 | Streptococcus pantholopis |
| 25 | 1047965 | 1048147 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 26 | 1572413 | 1572595 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 27 | 1633230 | 1633412 | - | NZ_CP016953.1 | Streptococcus himalayensis |
| 28 | 1175668 | 1175850 | + | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 29 | 971394 | 971576 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 30 | 916292 | 916474 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 31 | 866399 | 866581 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 32 | 1188202 | 1188384 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 33 | 891500 | 891682 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 34 | 943749 | 943931 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 35 | 673437 | 673619 | - | NZ_LT906439.1 | Streptococcus merionis |
| 36 | 450938 | 451126 | + | NZ_CP023392.1 | Lactococcus raffinolactis |
| 37 | 988144 | 988326 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 38 | 1597422 | 1597607 | + | NZ_CP017194.1 | Lactococcus carnosus |
| 39 | 1713891 | 1714079 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 40 | 1342896 | 1343081 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 41 | 530739 | 530924 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 42 | 1265947 | 1266132 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 43 | 672698 | 672880 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 44 | 1347346 | 1347525 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 45 | 1538726 | 1538902 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 46 | 1244477 | 1244653 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 47 | 1722299 | 1722466 | - | NZ_CP014161.1 | Aerococcus urinae |
| 48 | 564745 | 564933 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 49 | 1148039 | 1148227 | - | NZ_CP047361.1 | Macrococcus canis |
| 50 | 1293902 | 1294081 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 51 | 1840615 | 1840794 | - | NZ_CP065211.1 | Enterococcus lactis |
| 52 | 2568913 | 2569092 | - | NZ_CP023011.2 | Enterococcus hirae |
| 53 | 887459 | 887638 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 54 | 2542631 | 2542816 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 55 | 1720049 | 1720228 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 56 | 2643753 | 2643938 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 57 | 782131 | 782298 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 58 | 2540244 | 2540429 | + | NZ_LR134483.1 | Listeria grayi |
| 59 | 2668398 | 2668583 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 60 | 2554541 | 2554726 | + | NZ_LT906444.1 | Listeria welshimeri |
| 61 | 4310218 | 4310403 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 62 | 1149740 | 1149928 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 63 | 515133 | 515318 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 64 | 4154897 | 4155082 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 65 | 1323566 | 1323751 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 66 | 697650 | 697829 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 67 | 1291014 | 1291199 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 68 | 270607 | 270795 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 69 | 1369561 | 1369746 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 70 | 873281 | 873466 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
++ More..