Result : P0CZ12
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein pufQ |
| NCBI Accession ID | M22752.1 |
| Organism | Rhodobacter capsulatus (Rhodopseudomonas capsulata) |
| Left | 549 |
| Right | 773 |
| Strand | + |
| Nucleotide Sequence | ATGCAAAGCCAGCGTCTTCGCGCTCATGGGGTCCAACATGTCGACCGCGTGCCGCGTCCCGAGTTCGCGCTTTACTTTTCGCTGATCCTGATCGTCGCGGTGCCTTTCGCGCTGGTCGGCTGGGTCATGGCCCTGGTGCGCGAGCGCCGCATCCCCGAGTGCGGGCCCTTCGCCCGCGCCTGGCGCGAGGCGGGCGAGATCACGCCCGAGATTTTCCGGCCCTGA |
| Sequence | MQSQRLRAHGVQHVDRVPRPEFALYFSLILIVAVPFALVGWVMALVRERRIPECGPFARAWREAGEITPEIFRP |
| Source of smORF | Swiss-Prot |
| Function | Required for bacteriochlorophyll biosynthesis. Directly involved in the assembly of both the B875 and B800-850 pigment-protein complexes. |
| Pubmed ID | 2492501 |
| Domain | CDD:310184 |
| Functional Category | Others |
| Uniprot ID | P0CZ12 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 783848 | 784072 | + | NZ_CP061202.1 | Rhodobacter capsulatus |
| 2 | 3907593 | 3907829 | + | NZ_CP034328.1 | Tabrizicola piscis |
| 3 | 46471 | 46665 | + | NZ_CP020470.1 | Rhodobacter blasticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034328.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00891.20 | 1.0 | 3 | 5121 | same-strand | O-methyltransferase domain |
| 2 | PF13489.8 | 1.0 | 3 | 5121 | same-strand | Methyltransferase domain |
| 3 | PF13649.8 | 1.0 | 3 | 5121 | same-strand | Methyltransferase domain |
| 4 | PF00142.20 | 1.0 | 3 | 3089 | same-strand | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family |
| 5 | PF01656.25 | 1.0 | 3 | 3089 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 6 | PF00148.21 | 1.0 | 3 | 750.5 | same-strand | Nitrogenase component 1 type Oxidoreductase |
| 7 | PF08369.12 | 1.0 | 3 | 2 | same-strand | Proto-chlorophyllide reductase 57 kD subunit |
| 8 | PF00556.22 | 1.0 | 3 | 272.0 | same-strand | Antenna complex alpha/beta subunit |
| 9 | PF00124.21 | 1.0 | 3 | 1085.5 | same-strand | Photosynthetic reaction centre protein |
| 10 | PF11511.10 | 1.0 | 3 | 2458 | same-strand | Intrinsic membrane protein PufX |
| 11 | PF16864.7 | 0.67 | 2 | 5163.5 | same-strand | Dimerisation domain |
| 12 | PF08242.14 | 0.67 | 2 | 5163.5 | same-strand | Methyltransferase domain |
++ More..