Result : P0CY92
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Ferredoxin-4 (Ferredoxin IV) (FdIV) (Ferredoxin, plant-type) |
| NCBI Accession ID | M59855.1 |
| Organism | Rhodobacter capsulatus (Rhodopseudomonas capsulata) |
| Left | 197 |
| Right | 484 |
| Strand | + |
| Nucleotide Sequence | ATGGACAAGGCCACACTGACGTTCACCGATGTCTCGATCACGGTCAACGTGCCCACCGGAACCCGCATCATCGAGATGTCGGAAAAGGTCGGCTCGGGCATCACCTACGGCTGCCGCGAGGGCGAATGCGGCACCTGCATGACCCATATCCTCGAAGGGTCGGAAAACCTGTCGGAACCGACCGCGCTGGAAATGCGGGTGCTGGAGGAAAACCTGGGCGGCAAGGATGACCGTCTGGCCTGCCAGTGCCGGGTGCTGGGCGGCGCCGTCAAGGTTCGCCCCGCCTGA |
| Sequence | MDKATLTFTDVSITVNVPTGTRIIEMSEKVGSGITYGCREGECGTCMTHILEGSENLSEPTALEMRVLEENLGGKDDRLACQCRVLGGAVKVRPA |
| Source of smORF | Swiss-Prot |
| Function | Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. This ferredoxin is required for nitrogen fixation (By similarity). {ECO:0000250}. |
| Pubmed ID | 1847145 8264535 |
| Domain | CDD:412190 |
| Functional Category | Metal-binding |
| Uniprot ID | P0CY92 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 21
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3332861 | 3333148 | - | NZ_CP061202.1 | Rhodobacter capsulatus |
| 2 | 1519650 | 1519937 | + | NZ_CP012661.1 | Defluviimonas alba |
| 3 | 1002602 | 1002889 | - | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 4 | 1780305 | 1780592 | + | NC_015572.1 | Methylomonas methanica MC09 |
| 5 | 1289063 | 1289350 | - | NZ_CP014476.1 | Methylomonas denitrificans |
| 6 | 570776 | 571063 | + | NZ_CP016210.1 | Azoarcus olearius |
| 7 | 2329049 | 2329333 | + | NC_018012.1 | Thiocystis violascens DSM 198 |
| 8 | 3861871 | 3862158 | - | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 9 | 801213 | 801500 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 10 | 1302709 | 1302993 | + | NZ_AP017372.2 | Halorhodospira halochloris |
| 11 | 3424429 | 3424713 | + | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 12 | 821049 | 821333 | - | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 13 | 3396319 | 3396609 | + | NZ_CP010803.1 | Martelella endophytica |
| 14 | 1089748 | 1090032 | + | NZ_CP072793.1 | Thiothrix unzii |
| 15 | 3856578 | 3856859 | + | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 16 | 3856927 | 3857214 | + | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 17 | 3561700 | 3561984 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 18 | 3604106 | 3604390 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 19 | 307233 | 307517 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 20 | 1341540 | 1341827 | - | NZ_CP064781.1 | Azospira restricta |
| 21 | 2058213 | 2058500 | + | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 22 | 427873 | 428160 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP043929.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13187.8 | 0.81 | 17 | 1842.0 | same-strand | 4Fe-4S dicluster domain |
| 2 | PF12838.9 | 0.81 | 17 | 1863.0 | same-strand | 4Fe-4S dicluster domain |
| 3 | PF00111.29 | 0.67 | 14 | 28 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 4 | PF04891.14 | 0.62 | 13 | 430.5 | same-strand | NifQ |
| 5 | PF04055.23 | 0.71 | 15 | 1949 | same-strand | Radical SAM superfamily |
| 6 | PF02579.19 | 0.81 | 17 | 2068 | same-strand | Dinitrogenase iron-molybdenum cofactor |
++ More..