Protein Information |
Information Type | Description |
---|---|
Protein name | Ferredoxin-4 (Ferredoxin IV) (FdIV) (Ferredoxin, plant-type) |
NCBI Accession ID | M59855.1 |
Organism | Rhodobacter capsulatus (Rhodopseudomonas capsulata) |
Left | 197 |
Right | 484 |
Strand | + |
Nucleotide Sequence | ATGGACAAGGCCACACTGACGTTCACCGATGTCTCGATCACGGTCAACGTGCCCACCGGAACCCGCATCATCGAGATGTCGGAAAAGGTCGGCTCGGGCATCACCTACGGCTGCCGCGAGGGCGAATGCGGCACCTGCATGACCCATATCCTCGAAGGGTCGGAAAACCTGTCGGAACCGACCGCGCTGGAAATGCGGGTGCTGGAGGAAAACCTGGGCGGCAAGGATGACCGTCTGGCCTGCCAGTGCCGGGTGCTGGGCGGCGCCGTCAAGGTTCGCCCCGCCTGA |
Sequence | MDKATLTFTDVSITVNVPTGTRIIEMSEKVGSGITYGCREGECGTCMTHILEGSENLSEPTALEMRVLEENLGGKDDRLACQCRVLGGAVKVRPA |
Source of smORF | Swiss-Prot |
Function | Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. This ferredoxin is required for nitrogen fixation (By similarity). {ECO:0000250}. |
Pubmed ID | 1847145 8264535 |
Domain | CDD:412190 |
Functional Category | Metal-binding |
Uniprot ID | P0CY92 |
ORF Length (Amino Acid) | 95 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3332861 | 3333148 | - | NZ_CP061202.1 | Rhodobacter capsulatus |
2 | 1519650 | 1519937 | + | NZ_CP012661.1 | Defluviimonas alba |
3 | 1002602 | 1002889 | - | NZ_CP043929.1 | Methylomonas rhizoryzae |
4 | 1780305 | 1780592 | + | NC_015572.1 | Methylomonas methanica MC09 |
5 | 1289063 | 1289350 | - | NZ_CP014476.1 | Methylomonas denitrificans |
6 | 570776 | 571063 | + | NZ_CP016210.1 | Azoarcus olearius |
7 | 2329049 | 2329333 | + | NC_018012.1 | Thiocystis violascens DSM 198 |
8 | 3861871 | 3862158 | - | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
9 | 801213 | 801500 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
10 | 1302709 | 1302993 | + | NZ_AP017372.2 | Halorhodospira halochloris |
11 | 3424429 | 3424713 | + | NC_013851.1 | Allochromatium vinosum DSM 180 |
12 | 821049 | 821333 | - | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
13 | 3396319 | 3396609 | + | NZ_CP010803.1 | Martelella endophytica |
14 | 1089748 | 1090032 | + | NZ_CP072793.1 | Thiothrix unzii |
15 | 3856578 | 3856859 | + | NZ_CP012373.2 | Beggiatoa leptomitoformis |
16 | 3856927 | 3857214 | + | NZ_CP012373.2 | Beggiatoa leptomitoformis |
17 | 3561700 | 3561984 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
18 | 3604106 | 3604390 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
19 | 307233 | 307517 | - | NC_008789.1 | Halorhodospira halophila SL1 |
20 | 1341540 | 1341827 | - | NZ_CP064781.1 | Azospira restricta |
21 | 2058213 | 2058500 | + | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
22 | 427873 | 428160 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13187.8 | 0.81 | 17 | 1842.0 | same-strand | 4Fe-4S dicluster domain |
2 | PF12838.9 | 0.81 | 17 | 1863.0 | same-strand | 4Fe-4S dicluster domain |
3 | PF00111.29 | 0.67 | 14 | 28 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
4 | PF04891.14 | 0.62 | 13 | 430.5 | same-strand | NifQ |
5 | PF04055.23 | 0.71 | 15 | 1949 | same-strand | Radical SAM superfamily |
6 | PF02579.19 | 0.81 | 17 | 2068 | same-strand | Dinitrogenase iron-molybdenum cofactor |