Result : A4WFD6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein TusB (tRNA 2-thiouridine synthesizing protein B) |
| NCBI Accession ID | CP000653.1 |
| Organism | Enterobacter sp. (strain 638) |
| Left | 4059719 |
| Right | 4060006 |
| Strand | - |
| Nucleotide Sequence | ATGCTTCACACTCTGAGCCATTCACCATGGCATGCTGATATCGAAGGGTTGCTGAGAATGCTGGGCGACGGCGATGAATTGTTGCTGATCCAGGATGGCGTTCTTGCCGCCATTGACGGCGGGCGCTTCATTGAAATCCTCAATAATGCCCCCATTAAGGTCATAGCGCTGAAAGATGACATAGATGCCCGCGGTCTTGCTGGTCAAATTTCCACCAAAATTGACGTTGTTGGCTATACTGACTTCGTCAAACTAGCGATTAAGCACCCGACTCAAATGAGTTGGTGA |
| Sequence | MLHTLSHSPWHADIEGLLRMLGDGDELLLIQDGVLAAIDGGRFIEILNNAPIKVIALKDDIDARGLAGQISTKIDVVGYTDFVKLAIKHPTQMSW |
| Source of smORF | Swiss-Prot |
| Function | Part of a sulfur-relay system required for 2-thiolation of 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) at tRNA wobble positions. {ECO:0000255|HAMAP-Rule:MF_01564}. |
| Pubmed ID | 20485560 |
| Domain | CDD:412512 |
| Functional Category | Others |
| Uniprot ID | A4WFD6 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 90
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3004676 | 3004963 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 2 | 4317674 | 4317961 | - | NC_015968.1 | Enterobacter soli |
| 3 | 2996326 | 2996613 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 4 | 4303211 | 4303498 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 5 | 2036126 | 2036413 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 6 | 438566 | 438853 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 7 | 4043405 | 4043692 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 8 | 2865771 | 2866058 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 9 | 4210286 | 4210573 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 10 | 4407227 | 4407514 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 11 | 4639328 | 4639615 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 12 | 4299112 | 4299399 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 13 | 4728211 | 4728498 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 14 | 3474678 | 3474965 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 15 | 413743 | 414030 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 16 | 1646274 | 1646561 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 17 | 970143 | 970430 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 18 | 4357956 | 4358186 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 19 | 5131076 | 5131363 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 20 | 496450 | 496737 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 21 | 4881179 | 4881466 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 22 | 423281 | 423568 | + | NZ_CP054254.1 | Klebsiella variicola |
| 23 | 36002 | 36289 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 24 | 417558 | 417845 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 25 | 442789 | 443076 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 26 | 2107226 | 2107513 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 27 | 365226 | 365513 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 28 | 2380862 | 2381149 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 29 | 2704142 | 2704429 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 30 | 3435580 | 3435867 | - | NZ_AP014857.1 | Escherichia albertii |
| 31 | 4194712 | 4194999 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 32 | 3550434 | 3550721 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 33 | 3443955 | 3444242 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 34 | 4877202 | 4877489 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 35 | 2820991 | 2821278 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 36 | 2261595 | 2261882 | - | NZ_CP033744.1 | Citrobacter freundii |
| 37 | 4454203 | 4454490 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 38 | 450434 | 450721 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 39 | 365876 | 366163 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 40 | 397153 | 397440 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 41 | 535599 | 535886 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 42 | 3975271 | 3975558 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 43 | 3819378 | 3819665 | + | NZ_CP038469.1 | Citrobacter tructae |
| 44 | 722352 | 722639 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 45 | 1452967 | 1453254 | - | NZ_CP053416.1 | Salmonella bongori |
| 46 | 4187204 | 4187491 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 47 | 3897915 | 3898202 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 48 | 3788477 | 3788764 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 49 | 4597142 | 4597429 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 50 | 215733 | 216020 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 51 | 1171208 | 1171495 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 52 | 3602842 | 3603129 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 53 | 3537933 | 3538220 | - | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 54 | 5019695 | 5019982 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 55 | 4817210 | 4817497 | - | NZ_LT906479.1 | Serratia ficaria |
| 56 | 69717 | 70004 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 57 | 1325729 | 1326016 | - | NZ_CP011254.1 | Serratia fonticola |
| 58 | 452678 | 452965 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 59 | 414338 | 414625 | + | NZ_CP041247.1 | Raoultella electrica |
| 60 | 307256 | 307543 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 61 | 4065155 | 4065442 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 62 | 1263798 | 1264085 | - | NZ_CP026047.1 | Raoultella planticola |
| 63 | 4947650 | 4947937 | - | NZ_LR134494.1 | Serratia quinivorans |
| 64 | 1197077 | 1197364 | - | NZ_CP019706.1 | Pantoea alhagi |
| 65 | 3962761 | 3963048 | - | NZ_LR134340.1 | Escherichia marmotae |
| 66 | 4081011 | 4081298 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 67 | 4903644 | 4903931 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 68 | 415900 | 416187 | + | NZ_CP050508.1 | Raoultella terrigena |
| 69 | 229569 | 229856 | + | NZ_LR134201.1 | Cedecea lapagei |
| 70 | 4852912 | 4853199 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 71 | 444512 | 444799 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 72 | 3491302 | 3491589 | - | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 73 | 384748 | 385035 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 74 | 394071 | 394358 | + | NZ_CP061511.1 | Mixta calida |
| 75 | 2457522 | 2457809 | - | NZ_CP049115.1 | Pantoea stewartii |
| 76 | 225062 | 225349 | + | NZ_CP023525.1 | Cedecea neteri |
| 77 | 4053832 | 4054122 | - | NZ_LT615367.1 | Dickeya aquatica |
| 78 | 3623597 | 3623884 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 79 | 302941 | 303225 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 80 | 4197653 | 4197940 | - | NZ_CP025799.1 | Dickeya zeae |
| 81 | 468689 | 468976 | + | NZ_CP026377.1 | Mixta gaviniae |
| 82 | 457821 | 458108 | + | NZ_CP038853.1 | Pantoea vagans |
| 83 | 3308274 | 3308561 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 84 | 329586 | 329873 | + | NZ_CP071320.1 | Serratia ureilytica |
| 85 | 4217665 | 4217952 | + | NZ_CP028271.1 | Mixta intestinalis |
| 86 | 2892481 | 2892768 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 87 | 447685 | 447972 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 88 | 1375593 | 1375880 | + | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 89 | 1654269 | 1654556 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 90 | 1125926 | 1126210 | - | NZ_CP065640.1 | Serratia rubidaea |
| 91 | 448176 | 448463 | + | NC_017554.1 | Pantoea ananatis PA13 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP023529.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04324.17 | 0.89 | 80 | 4709.0 | same-strand | BFD-like [2Fe-2S] binding domain |
| 2 | PF00009.29 | 1.0 | 90 | 2260.0 | same-strand | Elongation factor Tu GTP binding domain |
| 3 | PF03143.19 | 1.0 | 90 | 3347 | same-strand | Elongation factor Tu C-terminal domain |
| 4 | PF03144.27 | 1.0 | 90 | 2260.0 | same-strand | Elongation factor Tu domain 2 |
| 5 | PF01926.25 | 1.0 | 90 | 3347 | same-strand | 50S ribosome-binding GTPase |
| 6 | PF03764.20 | 1.0 | 90 | 1163 | same-strand | Elongation factor G, domain IV |
| 7 | PF14492.8 | 1.0 | 90 | 1163 | same-strand | Elongation Factor G, domain III |
| 8 | PF00679.26 | 1.0 | 90 | 1163 | same-strand | Elongation factor G C-terminus |
| 9 | PF00177.23 | 1.0 | 90 | 596 | same-strand | Ribosomal protein S7p/S5e |
| 10 | PF00164.27 | 1.0 | 90 | 126 | same-strand | Ribosomal protein S12/S23 |
| 11 | PF02635.17 | 1.0 | 90 | 364.0 | same-strand | DsrE/DsrF-like family |
| 12 | PF08348.13 | 1.0 | 90 | 753 | same-strand | YheO-like PAS domain |
| 13 | PF13309.8 | 1.0 | 90 | 753 | same-strand | HTH domain |
| 14 | PF13384.8 | 0.97 | 87 | 753.0 | same-strand | Homeodomain-like domain |
| 15 | PF00254.30 | 0.94 | 85 | 1644.0 | same-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |
| 16 | PF01346.20 | 0.94 | 85 | 1644.0 | same-strand | Domain amino terminal to FKBP-type peptidyl-prolyl isomerase |
| 17 | PF04102.14 | 0.92 | 83 | 2712.0 | opposite-strand | SlyX |
++ More..