| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Competence pheromone |
| NCBI Accession ID | AF456131.1 |
| Organism | Bacillus subtilis |
| Left | 886 |
| Right | 1062 |
| Strand | + |
| Nucleotide Sequence | ATGAAACAAGACATGATTGATTACTTAATGAAGAATCCGCAAGTTTTAACTAAATTAGAAAATGGAGAGGCGAGCTTAATAGGAATTCCAGATAAACTAATCCCTTCAATTGTAGATATTTTCAACAAAAAAATGACTCTTTCAAAGAAATGCAAGGGAATTTTCTGGGAGCAATAA |
| Sequence | MKQDMIDYLMKNPQVLTKLENGEASLIGIPDKLIPSIVDIFNKKMTLSKKCKGIFWEQ |
| Source of smORF | Swiss-Prot |
| Function | Part of a major quorum-sensing system that regulates the development of genetic competence. Acts through the activation of the two-component regulatory system ComP/ComA composed of a sensor histidine kinase, ComP, and a response regulator, ComA, that regulates directly the transcription of over 20 genes. Transport through the membrane may involve Spo0K. Under certain conditions plays a role in sporulation. |
| Pubmed ID | 12067344 11133937 14679219 |
| Domain | CDD:368681 |
| Functional Category | Others |
| Uniprot ID | P0CY50 |
| ORF Length (Amino Acid) | 58 |