Protein Information |
Information Type | Description |
---|---|
Protein name | Putative antitoxin VapB16 |
NCBI Accession ID | AL123456.3 |
Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
Left | 2506207 |
Right | 2506383 |
Strand | - |
Nucleotide Sequence | TTGGCGCTGTGGTATCAGGCGATGATCGCGAAGTTTGGTGAGCAGGTGGTCGACGCGAAAGTCTGGGCGCCTGCGAAGCGGGTCGGCGTTCACGAGGCGAAGACACGCCTGTCCGAGCTGCTGCGGCTCGTCTACGGCGGGCAGAGGTTGAGATTGCCCGCCGCGGCGAGCCGGTAG |
Sequence | MALWYQAMIAKFGEQVVDAKVWAPAKRVGVHEAKTRLSELLRLVYGGQRLRLPAAASR |
Source of smORF | Swiss-Prot |
Function | Putative antitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapC16. {ECO:0000305|Pubmed:15718296}. |
Pubmed ID | 9634230 15718296 |
Domain | |
Functional Category | Antitoxin_type_2 |
Uniprot ID | P0CW31 |
ORF Length (Amino Acid) | 58 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2506207 | 2506383 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
2 | 2559051 | 2559227 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF09859.11 | 1.0 | 2 | 4575.0 | opposite-strand | Oxygenase, catalysing oxidative methylation of damaged DNA |
2 | PF00300.24 | 1.0 | 2 | 3469.0 | same-strand | Histidine phosphatase superfamily (branch 1) |
3 | PF13456.8 | 1.0 | 2 | 3469.0 | same-strand | Reverse transcriptase-like |
4 | PF00075.26 | 1.0 | 2 | 3469.0 | same-strand | RNase H |
5 | PF02591.17 | 1.0 | 2 | 2735.0 | same-strand | C4-type zinc ribbon domain |
6 | PF01784.20 | 1.0 | 2 | 1599.0 | same-strand | NIF3 (NGG1p interacting factor 3) |
7 | PF00155.23 | 1.0 | 2 | 508.0 | same-strand | Aminotransferase class I and II |
8 | PF13419.8 | 1.0 | 2 | 138.0 | opposite-strand | Haloacid dehalogenase-like hydrolase |
9 | PF00702.28 | 1.0 | 2 | 138.0 | opposite-strand | haloacid dehalogenase-like hydrolase |
10 | PF12710.9 | 1.0 | 2 | 138.0 | opposite-strand | haloacid dehalogenase-like hydrolase |
11 | PF01451.23 | 1.0 | 2 | 763.0 | opposite-strand | Low molecular weight phosphotyrosine protein phosphatase |
12 | PF02104.17 | 1.0 | 2 | 1254.0 | opposite-strand | SURF1 family |
13 | PF03186.15 | 1.0 | 2 | 2051.0 | same-strand | CobD/Cbib protein |
14 | PF09995.11 | 1.0 | 2 | 3058.0 | opposite-strand | ER-bound oxygenase mpaB/B'/Rubber oxygenase, catalytic domain |