Result : P0CW31
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antitoxin VapB16 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 2506207 |
| Right | 2506383 |
| Strand | - |
| Nucleotide Sequence | TTGGCGCTGTGGTATCAGGCGATGATCGCGAAGTTTGGTGAGCAGGTGGTCGACGCGAAAGTCTGGGCGCCTGCGAAGCGGGTCGGCGTTCACGAGGCGAAGACACGCCTGTCCGAGCTGCTGCGGCTCGTCTACGGCGGGCAGAGGTTGAGATTGCCCGCCGCGGCGAGCCGGTAG |
| Sequence | MALWYQAMIAKFGEQVVDAKVWAPAKRVGVHEAKTRLSELLRLVYGGQRLRLPAAASR |
| Source of smORF | Swiss-Prot |
| Function | Putative antitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapC16. {ECO:0000305|Pubmed:15718296}. |
| Pubmed ID | 9634230 15718296 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P0CW31 |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2506207 | 2506383 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2559051 | 2559227 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09859.11 | 1.0 | 2 | 4575.0 | opposite-strand | Oxygenase, catalysing oxidative methylation of damaged DNA |
| 2 | PF00300.24 | 1.0 | 2 | 3469.0 | same-strand | Histidine phosphatase superfamily (branch 1) |
| 3 | PF13456.8 | 1.0 | 2 | 3469.0 | same-strand | Reverse transcriptase-like |
| 4 | PF00075.26 | 1.0 | 2 | 3469.0 | same-strand | RNase H |
| 5 | PF02591.17 | 1.0 | 2 | 2735.0 | same-strand | C4-type zinc ribbon domain |
| 6 | PF01784.20 | 1.0 | 2 | 1599.0 | same-strand | NIF3 (NGG1p interacting factor 3) |
| 7 | PF00155.23 | 1.0 | 2 | 508.0 | same-strand | Aminotransferase class I and II |
| 8 | PF13419.8 | 1.0 | 2 | 138.0 | opposite-strand | Haloacid dehalogenase-like hydrolase |
| 9 | PF00702.28 | 1.0 | 2 | 138.0 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 10 | PF12710.9 | 1.0 | 2 | 138.0 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 11 | PF01451.23 | 1.0 | 2 | 763.0 | opposite-strand | Low molecular weight phosphotyrosine protein phosphatase |
| 12 | PF02104.17 | 1.0 | 2 | 1254.0 | opposite-strand | SURF1 family |
| 13 | PF03186.15 | 1.0 | 2 | 2051.0 | same-strand | CobD/Cbib protein |
| 14 | PF09995.11 | 1.0 | 2 | 3058.0 | opposite-strand | ER-bound oxygenase mpaB/B'/Rubber oxygenase, catalytic domain |
++ More..