Result : P0CL61
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin MazE9 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 3110507 |
| Right | 3110737 |
| Strand | - |
| Nucleotide Sequence | GTGAAGTTGAGCGTGAGCCTGTCCGATGACGACGTCGCGATCCTGGACGCATATGTGAAACGAGCGGGATTACCATCCCGCTCCGCCGGCCTGCAGCATGCGATCCGCGTGCTTCGCTACCCCACGCTCGAAGATGACTATGCCAACGCATGGCAAGAATGGTCGGCAGCCGGCGACACGGACGCGTGGGAGCAGACCGTCGGCGACGGAGTCGGTGATGCGCCGCGGTGA |
| Sequence | MKLSVSLSDDDVAILDAYVKRAGLPSRSAGLQHAIRVLRYPTLEDDYANAWQEWSAAGDTDAWEQTVGDGVGDAPR |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli and M.smegmatis neutralizes the effect of cognate toxin MazF9. {ECO:0000269|Pubmed:19016878, ECO:0000269|Pubmed:20011113, ECO:0000269|Pubmed:20876537}. |
| Pubmed ID | 9634230 15718296 16611633 19016878 20011113 20876537 25608501 |
| Domain | CDD:425357 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P0CL61 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 26
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3110507 | 3110737 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2363552 | 2363782 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 3 | 3169972 | 3170202 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 4 | 1678668 | 1678898 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 5 | 373948 | 374178 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 6 | 1217966 | 1218196 | - | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 7 | 2278534 | 2278764 | - | NZ_AP022562.1 | Mycobacterium novum |
| 8 | 2850308 | 2850538 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 9 | 4336368 | 4336598 | + | NC_015576.1 | Mycolicibacter sinensis |
| 10 | 1572713 | 1572943 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 11 | 3025430 | 3025660 | - | NZ_CP049863.1 | Leucobacter viscericola |
| 12 | 4999567 | 4999797 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 13 | 1123009 | 1123239 | - | NZ_CP049934.1 | Leucobacter insecticola |
| 14 | 4453079 | 4453321 | + | NZ_CP041146.1 | Nocardioides humi |
| 15 | 4861223 | 4861453 | - | NZ_CP061007.1 | Saccharopolyspora spinosa |
| 16 | 5197341 | 5197571 | + | NZ_CP031142.1 | Saccharopolyspora pogona |
| 17 | 2162714 | 2162932 | - | NZ_LR134406.1 | Arachnia propionica |
| 18 | 1775867 | 1776085 | + | NZ_LT985188.1 | Micropruina glycogenica |
| 19 | 1992386 | 1992613 | - | NZ_CP019400.1 | Acidipropionibacterium acidipropionici |
| 20 | 235668 | 235898 | + | NZ_CP025198.1 | Acidipropionibacterium virtanenii |
| 21 | 1448888 | 1449118 | - | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 22 | 3673380 | 3673604 | - | NZ_CP015163.1 | Amycolatopsis albispora |
| 23 | 690449 | 690679 | + | NZ_CP039291.1 | Cellulomonas shaoxiangyii |
| 24 | 1486208 | 1486447 | - | NZ_CP066060.1 | Actinomyces oris |
| 25 | 3286072 | 3286302 | - | NZ_CP040887.1 | Serinicoccus chungangensis |
| 26 | 1704915 | 1705145 | + | NZ_CP044427.1 | Ornithinimicrobium pratense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02452.19 | 0.88 | 23 | -13 | same-strand | PemK-like, MazF-like toxin of type II toxin-antitoxin system |
++ More..