Result : P0CL60
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin MazE8 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 2546839 |
| Right | 2547087 |
| Strand | - |
| Nucleotide Sequence | ATGGCCGAACCAGAAACCCTTCCTGGGCGGTGGCTTCCGGAATGCGCCTGCCTAGCTGAAACCGTGAGTTGGGAGCAGAGTCGTCTCTGGTCCCGCCTGTTATGCCGTCCGCATTTTCGTCATGCGCTGCCGGGGCTGACCGGGGGCTCTGCAAGTCGTCCGTCGGCGAGATCAGCACGCCTGGTTCGGCAGCCACGTATGACATTGTTTTCCTTGGACCATAGGGACGGGGTCGACGCTCGGTGTTGA |
| Sequence | MAEPETLPGRWLPECACLAETVSWEQSRLWSRLLCRPHFRHALPGLTGGSASRPSARSARLVRQPRMTLFSLDHRDGVDARC |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Its cognate toxin is MazF8. |
| Pubmed ID | 9634230 15718296 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P0CL60 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2546839 | 2547087 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2602663 | 2602911 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10905.10 | 1.0 | 2 | 1208.0 | opposite-strand | Protein of unknown function (DUF2695) |
| 2 | PF02656.17 | 1.0 | 2 | 571.0 | opposite-strand | Domain of unknown function (DUF202) |
| 3 | PF16715.7 | 1.0 | 2 | -204.0 | opposite-strand | Cyclodipeptide synthase |
| 4 | PF03009.19 | 1.0 | 2 | 2037.5 | same-strand | Glycerophosphoryl diester phosphodiesterase family |
++ More..