Protein Information |
Information Type | Description |
---|---|
Protein name | Antitoxin MazE8 |
NCBI Accession ID | AL123456.3 |
Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
Left | 2546839 |
Right | 2547087 |
Strand | - |
Nucleotide Sequence | ATGGCCGAACCAGAAACCCTTCCTGGGCGGTGGCTTCCGGAATGCGCCTGCCTAGCTGAAACCGTGAGTTGGGAGCAGAGTCGTCTCTGGTCCCGCCTGTTATGCCGTCCGCATTTTCGTCATGCGCTGCCGGGGCTGACCGGGGGCTCTGCAAGTCGTCCGTCGGCGAGATCAGCACGCCTGGTTCGGCAGCCACGTATGACATTGTTTTCCTTGGACCATAGGGACGGGGTCGACGCTCGGTGTTGA |
Sequence | MAEPETLPGRWLPECACLAETVSWEQSRLWSRLLCRPHFRHALPGLTGGSASRPSARSARLVRQPRMTLFSLDHRDGVDARC |
Source of smORF | Swiss-Prot |
Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Its cognate toxin is MazF8. |
Pubmed ID | 9634230 15718296 |
Domain | |
Functional Category | Antitoxin_type_2 |
Uniprot ID | P0CL60 |
ORF Length (Amino Acid) | 82 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2546839 | 2547087 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
2 | 2602663 | 2602911 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF10905.10 | 1.0 | 2 | 1208.0 | opposite-strand | Protein of unknown function (DUF2695) |
2 | PF02656.17 | 1.0 | 2 | 571.0 | opposite-strand | Domain of unknown function (DUF202) |
3 | PF16715.7 | 1.0 | 2 | -204.0 | opposite-strand | Cyclodipeptide synthase |
4 | PF03009.19 | 1.0 | 2 | 2037.5 | same-strand | Glycerophosphoryl diester phosphodiesterase family |