Result : P0CG96
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein Rv3118 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 3484809 |
| Right | 3485111 |
| Strand | + |
| Nucleotide Sequence | ATGTGCTCTGGACCCAAGCAAGGACTGACATTGCCGGCCAGCGTCGACCTGGAAAAAGAAACGGTGATCACCGGCCGCGTAGTGGACGGTGACGGCCAGGCCGTGGGCGGCGCGTTCGTGCGGCTGCTGGACTCCTCCGACGAGTTCACCGCGGAGGTCGTCGCGTCGGCCACCGGCGATTTCCGGTTCTTCGCCGCGCCCGGATCCTGGACGCTGCGCGCGCTGTCGGCGGCCGGCAACGGCGACGCGGTGGTGCAGCCCTCGGGCGCGGGCATCCACGAGGTAGACGTCAAGATCACCTGA |
| Sequence | MCSGPKQGLTLPASVDLEKETVITGRVVDGDGQAVGGAFVRLLDSSDEFTAEVVASATGDFRFFAAPGSWTLRALSAAGNGDAVVQPSGAGIHEVDVKIT |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl21470. Profile Description: Peptidase associated domain: C-terminal domain of M14 N/E carboxypeptidase; putative folding, regulation, or interaction domain. This is the N-terminal of Calcineurin-like phosphoesterases. It is around 150 residues in length from various Bacteroides species. The function of this family is unknown. |
| Pubmed ID | 9634230 20066036 21969609 |
| Domain | CDD:419676 |
| Functional Category | Others |
| Uniprot ID | P0CG96 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 224
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3484809 | 3485111 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 908181 | 908483 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 665631 | 665933 | - | NC_016948.1 | Mycobacterium paraintracellulare |
| 4 | 915893 | 916195 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 5 | 656955 | 657257 | - | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 6 | 639452 | 639754 | - | NZ_CP023147.1 | Mycobacterium marseillense |
| 7 | 5121805 | 5122107 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 8 | 2142009 | 2142311 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 9 | 160282 | 160584 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 10 | 4864582 | 4864884 | + | NZ_LR130759.1 | Mycobacterium basiliense |
| 11 | 4700532 | 4700834 | - | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 12 | 1777003 | 1777305 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 13 | 3599920 | 3600222 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 14 | 3543771 | 3544073 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 15 | 5316316 | 5316618 | - | NZ_AP022590.1 | Mycobacterium mantenii |
| 16 | 5968056 | 5968358 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
| 17 | 2389341 | 2389643 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 18 | 3375999 | 3376301 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 19 | 659763 | 660065 | - | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 20 | 1109203 | 1109505 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 21 | 2690290 | 2690592 | + | NZ_AP022569.1 | Mycobacterium cookii |
| 22 | 3291814 | 3292116 | - | NZ_AP022568.1 | Mycobacterium simiae |
| 23 | 1995950 | 1996252 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 24 | 723540 | 723842 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 25 | 398782 | 399084 | + | NZ_CP043474.1 | Mycobacterium grossiae |
| 26 | 5117890 | 5118192 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 27 | 2258905 | 2259207 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 28 | 2389129 | 2389431 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 29 | 2889694 | 2889996 | + | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 30 | 2781424 | 2781726 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 31 | 4432022 | 4432324 | - | NZ_AP022576.1 | Mycobacterium florentinum |
| 32 | 4409054 | 4409356 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 33 | 3094235 | 3094537 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 34 | 5460309 | 5460611 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 35 | 1279590 | 1279892 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 36 | 4922981 | 4923283 | + | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 37 | 3597167 | 3597469 | + | NZ_AP022608.1 | Mycolicibacterium gadium |
| 38 | 5468108 | 5468410 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 39 | 5297370 | 5297672 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 40 | 1395222 | 1395524 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 41 | 4638578 | 4638880 | + | NZ_AP018164.1 | Mycobacterium shigaense |
| 42 | 4595635 | 4595937 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 43 | 6284254 | 6284556 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 44 | 5162309 | 5162611 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 45 | 693543 | 693845 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 46 | 3717834 | 3718136 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
| 47 | 1136370 | 1136672 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 48 | 3713569 | 3713871 | + | NZ_LT906469.1 | Mycolicibacter terrae |
| 49 | 5828603 | 5828905 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 50 | 4714547 | 4714849 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 51 | 3177194 | 3177496 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 52 | 569357 | 569659 | - | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 53 | 4072273 | 4072575 | - | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 54 | 3235478 | 3235780 | + | NZ_AP022605.1 | Mycobacterium doricum |
| 55 | 49398 | 49700 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 56 | 1105276 | 1105578 | + | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 57 | 3076855 | 3077157 | + | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 58 | 2495805 | 2496107 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 59 | 4143115 | 4143417 | + | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 60 | 3827486 | 3827788 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 61 | 2733686 | 2733988 | - | NZ_AP022562.1 | Mycobacterium novum |
| 62 | 3751691 | 3751993 | + | NC_015576.1 | Mycolicibacter sinensis |
| 63 | 5281989 | 5282291 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 64 | 652575 | 652880 | - | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 65 | 724404 | 724709 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
| 66 | 651075 | 651380 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 67 | 696937 | 697242 | - | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 68 | 857343 | 857648 | - | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 69 | 2548111 | 2548413 | + | NZ_CP029543.1 | Mycobacterium leprae |
| 70 | 705898 | 706200 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
| 71 | 732794 | 733096 | - | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 72 | 2532981 | 2533283 | - | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 73 | 688855 | 689160 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 74 | 5455311 | 5455613 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 75 | 895223 | 895525 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 76 | 3129582 | 3129884 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
| 77 | 5878593 | 5878895 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 78 | 3285409 | 3285711 | + | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 79 | 355809 | 356111 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 80 | 647161 | 647466 | - | NZ_AP023396.1 | Nocardia wallacei |
| 81 | 4965180 | 4965482 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 82 | 1408015 | 1408320 | - | NZ_LR134352.1 | Nocardia asteroides |
| 83 | 608356 | 608661 | - | NZ_CP018082.1 | Nocardia mangyaensis |
| 84 | 827045 | 827350 | + | NZ_CP015235.1 | Rhodococcus fascians D188 |
| 85 | 201061 | 201366 | + | NZ_CP059694.1 | Gordonia rubripertincta |
| 86 | 1036603 | 1036908 | + | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 87 | 5031218 | 5031523 | + | NZ_AP023172.1 | Rhodococcus qingshengii |
| 88 | 347853 | 348164 | - | NZ_CP048813.1 | Rhodococcus triatomae |
| 89 | 1817290 | 1817595 | - | NZ_CP027114.1 | Gordonia alkanivorans |
| 90 | 5824242 | 5824547 | + | NZ_CP022088.2 | Nocardia brasiliensis |
| 91 | 761048 | 761353 | - | NZ_CP011853.1 | Gordonia phthalatica |
| 92 | 6267912 | 6268217 | + | NZ_CP041695.1 | Nocardia otitidiscaviarum |
| 93 | 613037 | 613342 | - | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 94 | 4234663 | 4234968 | + | NC_013441.1 | Gordonia bronchialis DSM 43247 |
| 95 | 7417012 | 7417317 | + | NZ_AP017900.1 | Nocardia seriolae |
| 96 | 975656 | 975961 | - | NZ_CP027433.1 | Gordonia iterans |
| 97 | 1353278 | 1353583 | - | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 98 | 850623 | 850928 | - | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 99 | 2097826 | 2098131 | + | NZ_LS483468.1 | Rhodococcus coprophilus |
| 100 | 987690 | 987995 | - | NZ_CP027793.1 | Rhodococcus hoagii |
| 101 | 2518504 | 2518809 | + | NZ_CP033972.1 | Gordonia insulae |
| 102 | 952605 | 952910 | - | NZ_CP029146.1 | Rhodococcus ruber |
| 103 | 4629032 | 4629337 | + | NC_016906.1 | Gordonia polyisoprenivorans VH2 |
| 104 | 778562 | 778867 | - | NC_015564.1 | Hoyosella subflava DQS3-9A1 |
| 105 | 3659730 | 3660035 | + | NC_014158.1 | Tsukamurella paurometabola DSM 20162 |
| 106 | 3141139 | 3141444 | + | NC_014168.1 | Segniliparus rotundus DSM 44985 |
| 107 | 4123338 | 4123643 | + | NZ_CP019066.1 | Tsukamurella tyrosinosolvens |
| 108 | 3657541 | 3657831 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 109 | 1138537 | 1138836 | + | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 110 | 4365216 | 4365476 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 111 | 497650 | 497949 | - | NC_015312.1 | Pseudonocardia dioxanivorans CB1190 |
| 112 | 532936 | 533235 | - | NZ_AP018920.1 | Pseudonocardia autotrophica |
| 113 | 7106409 | 7106741 | - | NZ_AP022870.1 | Phytohabitans flavus |
| 114 | 8863208 | 8863537 | - | NC_022657.1 | Actinoplanes friuliensis DSM 7358 |
| 115 | 3117187 | 3117510 | - | NZ_AP022871.1 | Phytohabitans suffuscus |
| 116 | 9535471 | 9535728 | + | NZ_CP007155.1 | Kutzneria albida DSM 43870 |
| 117 | 339152 | 339478 | + | NC_009380.1 | Salinispora tropica CNB-440 |
| 118 | 7834966 | 7835229 | + | NZ_CP023865.1 | Actinoplanes teichomyceticus ATCC 31121 |
| 119 | 6380814 | 6381152 | - | NC_014391.1 | Micromonospora aurantiaca ATCC 27029 |
| 120 | 5038967 | 5039290 | - | NZ_CP045309.1 | Micromonospora terminaliae |
| 121 | 6799426 | 6799758 | - | NZ_CP058322.1 | Micromonospora carbonacea |
| 122 | 3988712 | 3988984 | + | NZ_CP061725.1 | Micromonospora craniellae |
| 123 | 8308410 | 8308652 | + | NC_017093.1 | Actinoplanes missouriensis 431 |
| 124 | 57763 | 58068 | + | NZ_AP023355.1 | Actinocatenispora thailandica |
| 125 | 3243130 | 3243429 | - | NZ_CP016793.1 | Lentzea guizhouensis |
| 126 | 10625319 | 10625573 | + | NZ_CP034550.1 | Saccharothrix syringae |
| 127 | 1092828 | 1093166 | + | NC_013947.1 | Stackebrandtia nassauensis DSM 44728 |
| 128 | 6860816 | 6861124 | - | NZ_CP015163.1 | Amycolatopsis albispora |
| 129 | 3155483 | 3155782 | + | NZ_CP061007.1 | Saccharopolyspora spinosa |
| 130 | 11439020 | 11439319 | + | NZ_CP012752.1 | Kibdelosporangium phytohabitans |
| 131 | 4858108 | 4858401 | - | NC_013757.1 | Geodermatophilus obscurus DSM 43160 |
| 132 | 7913776 | 7914081 | + | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 133 | 5570957 | 5571256 | + | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 134 | 6348441 | 6348698 | + | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
| 135 | 8573344 | 8573652 | + | NC_021252.1 | Amycolatopsis keratiniphila |
| 136 | 6852007 | 6852312 | + | NZ_CP016076.1 | Actinoalloteichus fjordicus |
| 137 | 9875511 | 9875822 | + | NC_022116.1 | Amycolatopsis mediterranei RB |
| 138 | 379663 | 379974 | - | NZ_CP016174.1 | Amycolatopsis orientalis |
| 139 | 8582047 | 8582355 | + | NZ_CP008953.1 | Amycolatopsis japonica |
| 140 | 4928781 | 4929080 | + | NZ_CP022752.1 | Actinopolyspora erythraea |
| 141 | 6835626 | 6835925 | - | NZ_CP031142.1 | Saccharopolyspora pogona |
| 142 | 7969317 | 7969571 | + | NC_013093.1 | Actinosynnema mirum DSM 43827 |
| 143 | 4608043 | 4608303 | + | NZ_CP045929.1 | Saccharopolyspora coralli |
| 144 | 7854974 | 7855228 | + | NZ_CP023445.1 | Actinosynnema pretiosum |
| 145 | 9015844 | 9016110 | + | NC_019673.1 | Saccharothrix espanaensis DSM 44229 |
| 146 | 4094160 | 4094441 | + | NC_013159.1 | Saccharomonospora viridis DSM 43017 |
| 147 | 4268881 | 4269177 | + | NZ_CP041091.1 | Nocardioides sambongensis |
| 148 | 9555668 | 9555913 | - | NC_013131.1 | Catenulispora acidiphila DSM 44928 |
| 149 | 5660523 | 5660810 | - | NZ_CP070326.1 | Streptomyces noursei |
| 150 | 4384415 | 4384702 | + | NZ_CP020563.1 | Kitasatospora albolonga |
| 151 | 4440943 | 4441230 | + | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 152 | 3401386 | 3401673 | - | NZ_CP031742.1 | Streptomyces koyangensis |
| 153 | 4987543 | 4987830 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 154 | 5118502 | 5118789 | - | NZ_CP023691.1 | Streptomyces platensis |
| 155 | 3958157 | 3958444 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 156 | 4616813 | 4617100 | + | NZ_CP051006.1 | Streptomyces griseofuscus |
| 157 | 3775536 | 3775823 | + | NC_020990.1 | Streptomyces albidoflavus |
| 158 | 3915890 | 3916177 | - | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 159 | 4557376 | 4557663 | - | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 160 | 3597982 | 3598269 | - | NZ_CP020700.1 | Streptomyces tsukubensis |
| 161 | 3499961 | 3500248 | - | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 162 | 4066499 | 4066786 | - | NZ_CP032698.1 | Streptomyces hundungensis |
| 163 | 3646259 | 3646546 | - | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 164 | 4912431 | 4912718 | + | NZ_CP027306.1 | Streptomyces atratus |
| 165 | 4657540 | 4657827 | + | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 166 | 6572964 | 6573254 | - | NZ_CP030862.1 | Streptomyces globosus |
| 167 | 4316848 | 4317135 | + | NZ_CP070242.1 | Streptomyces californicus |
| 168 | 4361622 | 4361909 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 169 | 4644846 | 4645133 | + | NZ_CP047020.1 | Streptomyces broussonetiae |
| 170 | 3508580 | 3508867 | - | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 171 | 4685145 | 4685432 | + | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 172 | 4086910 | 4087197 | + | NZ_CP024957.1 | Streptomyces cavourensis |
| 173 | 4676002 | 4676289 | - | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 174 | 3715265 | 3715552 | - | NZ_CP023703.1 | Streptomyces galilaeus |
| 175 | 3913317 | 3913604 | + | NZ_CP034279.1 | Streptomyces ficellus |
| 176 | 350410 | 350697 | + | NZ_CP051486.1 | Streptomyces pratensis |
| 177 | 4678986 | 4679273 | - | NZ_CP023690.1 | Streptomyces spectabilis |
| 178 | 4159576 | 4159866 | + | NZ_CP023701.1 | Streptomyces subrutilus |
| 179 | 1009135 | 1009434 | + | NC_008278.1 | Frankia alni ACN14a |
| 180 | 3126324 | 3126611 | - | NZ_CP065253.1 | Streptomyces clavuligerus |
| 181 | 3692516 | 3692803 | - | NZ_CP023695.1 | Streptomyces alboniger |
| 182 | 4900009 | 4900296 | + | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 183 | 3474497 | 3474784 | - | NZ_CP029043.1 | Streptomyces nigra |
| 184 | 3733549 | 3733836 | - | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 185 | 4697638 | 4697925 | + | NZ_CP026652.1 | Streptomyces dengpaensis |
| 186 | 5110093 | 5110380 | - | NZ_CP034463.1 | Streptomyces aquilus |
| 187 | 4645476 | 4645763 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 188 | 5144304 | 5144591 | - | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 189 | 3315011 | 3315298 | - | NZ_CP022310.1 | Streptomyces calvus |
| 190 | 4130375 | 4130662 | - | NC_021985.1 | Streptomyces collinus Tu 365 |
| 191 | 4946312 | 4946599 | - | NZ_CP060404.1 | Streptomyces buecherae |
| 192 | 4191127 | 4191414 | + | NZ_CP031194.1 | Streptomyces paludis |
| 193 | 4740246 | 4740533 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 194 | 5381266 | 5381553 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 195 | 5046378 | 5046665 | + | NZ_CP045643.1 | Streptomyces fagopyri |
| 196 | 4484712 | 4484999 | - | NZ_CP022685.1 | Streptomyces formicae |
| 197 | 4501621 | 4501908 | - | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 198 | 4442122 | 4442409 | - | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 199 | 4140702 | 4140989 | + | NZ_CP029196.1 | Streptomyces venezuelae |
| 200 | 6231610 | 6231897 | - | NZ_CP065050.1 | Streptomyces solisilvae |
| 201 | 4064007 | 4064297 | + | NZ_CP023692.1 | Streptomyces vinaceus |
| 202 | 5541615 | 5541902 | + | NC_013929.1 | Streptomyces scabiei 87.22 |
| 203 | 3562950 | 3563237 | - | NZ_CP023407.1 | Streptomyces fungicidicus |
| 204 | 4402657 | 4402947 | - | NZ_CP071139.1 | Streptomyces nojiriensis |
| 205 | 4277684 | 4277971 | + | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 206 | 3382136 | 3382423 | - | NZ_CP015866.1 | Streptomyces parvulus |
| 207 | 4521550 | 4521837 | + | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 208 | 2974334 | 2974621 | - | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 209 | 3105865 | 3106152 | - | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 210 | 10396090 | 10396377 | + | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 211 | 3259277 | 3259564 | - | NZ_CP029254.1 | Streptomyces spongiicola |
| 212 | 2674817 | 2675104 | - | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 213 | 1464929 | 1465216 | - | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 214 | 626352 | 626639 | + | NZ_CP063373.1 | Streptomyces ferrugineus |
| 215 | 4168280 | 4168567 | + | NZ_CP071839.1 | Streptomyces cyanogenus |
| 216 | 4215689 | 4215976 | + | NZ_CP023693.1 | Streptomyces cinereoruber |
| 217 | 4955234 | 4955521 | - | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 218 | 3472684 | 3472971 | - | NZ_AP023439.1 | Streptomyces tuirus |
| 219 | 4102562 | 4102849 | - | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 220 | 4227836 | 4228123 | - | NZ_CP015098.1 | Streptomyces qaidamensis |
| 221 | 5267876 | 5268163 | + | NZ_CP023689.1 | Streptomyces chartreusis |
| 222 | 6253596 | 6253883 | + | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 223 | 4275092 | 4275379 | - | NZ_CP048882.1 | Streptomyces bathyalis |
| 224 | 3893904 | 3894194 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 225 | 3798852 | 3799142 | - | NZ_CP063374.1 | Streptomyces chromofuscus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00581.22 | 0.99 | 221 | 6 | same-strand | Rhodanese-like domain |
| 2 | PF08768.13 | 0.71 | 159 | 253 | same-strand | THAP4-like, heme-binding beta-barrel domain |
| 3 | PF11209.10 | 0.99 | 221 | 1652 | same-strand | LmeA-like phospholipid-binding |
| 4 | PF00486.30 | 0.64 | 144 | 2976.0 | opposite-strand | Transcriptional regulatory protein, C terminal |
++ More..