Result : A4W2X8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0298 protein SSU98_1559 |
| NCBI Accession ID | CP000408.1 |
| Organism | Streptococcus suis (strain 98HAH33) |
| Left | 1479306 |
| Right | 1479578 |
| Strand | - |
| Nucleotide Sequence | ATGTTTGAGAAGAAAAATCGCACTTGCTTAACTGTCTATTTACACTACAATCGTGATGCACGTAAACTCAGCCAATATGGAGATATTGTTTACCATTCCAAACGCTTGCGATATGTTTTGGTGTATATGGATCAAGAACTAGTAGAAGCTACCATATTAAAATTGAAAAAGGAACGTTTTGTAAAAAAAGTGGTTCCTTCATACATTAAGGAATTAGACCAAAACTTTGTAGGTAATCTATGGAGAGATGAAGAACCATCAGTCGTAGGATAG |
| Sequence | MFEKKNRTCLTVYLHYNRDARKLSQYGDIVYHSKRLRYVLVYMDQELVEATILKLKKERFVKKVVPSYIKELDQNFVGNLWRDEEPSVVG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23792. Profile Description: Uncharacterized protein conserved in bacteria (DUF2129). hypothetical protein; Provisional |
| Pubmed ID | 17375201 |
| Domain | CDD:420011 |
| Functional Category | Others |
| Uniprot ID | A4W2X8 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1479563 | 1479835 | - | NC_012924.1 | Streptococcus suis SC84 |
| 2 | 620353 | 620622 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 3 | 60819 | 61070 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 4 | 1019123 | 1019371 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 5 | 974361 | 974639 | - | NZ_LT906439.1 | Streptococcus merionis |
| 6 | 1764137 | 1764409 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 7 | 1111214 | 1111480 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 8 | 47936 | 48184 | + | NZ_CP013237.1 | Streptococcus mutans |
| 9 | 1233806 | 1234054 | + | NZ_CP043405.1 | Streptococcus ratti |
| 10 | 992668 | 992904 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 11 | 1156749 | 1157033 | + | NZ_CP032620.1 | Streptococcus koreensis |
| 12 | 426276 | 426563 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 13 | 723143 | 723391 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 14 | 1427168 | 1427416 | - | NZ_LS483343.1 | Streptococcus ferus |
| 15 | 466910 | 467179 | + | NZ_CP034543.1 | Streptococcus periodonticum |
| 16 | 498260 | 498529 | + | NZ_CP012805.1 | Streptococcus anginosus |
| 17 | 454241 | 454498 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 18 | 369115 | 369396 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP016953.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 1.0 | 18 | 3781.5 | same-strand | ABC transporter |
| 2 | PF12399.10 | 1.0 | 18 | 3258.5 | same-strand | Branched-chain amino acid ATP-binding cassette transporter |
| 3 | PF02653.18 | 1.0 | 18 | 2007.0 | same-strand | Branched-chain amino acid transport system / permease component |
| 4 | PF13458.8 | 1.0 | 18 | 101.5 | same-strand | Periplasmic binding protein |
| 5 | PF01094.30 | 1.0 | 18 | 101.5 | same-strand | Receptor family ligand binding region |
| 6 | PF13433.8 | 0.61 | 11 | 102 | same-strand | Periplasmic binding protein domain |
| 7 | PF00574.25 | 1.0 | 18 | 326.0 | same-strand | Clp protease |
| 8 | PF14681.8 | 0.94 | 17 | 1204 | same-strand | Uracil phosphoribosyltransferase |
| 9 | PF00155.23 | 0.67 | 12 | 2934.5 | same-strand | Aminotransferase class I and II |
++ More..