Result : P0CF73
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Transposase InsE for insertion sequence IS3 |
| NCBI Accession ID | AH006325.2 |
| Organism | Escherichia coli O111:H- |
| Left | 1544 |
| Right | 1843 |
| Strand | + |
| Nucleotide Sequence | ATGACAAAAACAGTATCAACCAGTAAAAAACCCCGTAAACAGCATTCGCCTGAATTTCGCAGTGAAGCCCTGAAGCTTGCTGAACGCATCGGTGTTACTGCCGCAGCCCGTGAACTCAGCCTGTATGAATCACAGCTCTACAACTGGCGCAGTAAACAGCAAAATCAGCAGACGTCTTCTGAACGTGAACTGGAGATGTCTACCGAGATTGCACGTCTCAAACGCCAGCTGGCAGAACGGGATGAAGAGCTGGCTATCCTCCAAAAGGCCGCGACATACTTCGCGAAGCGCCTGAAATGA |
| Sequence | MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK |
| Source of smORF | Swiss-Prot |
| Function | Involved in the transposition of the insertion sequence IS3. |
| Pubmed ID | 9675859 |
| Domain | CDD:225511,CDD:419669 |
| Functional Category | DNA-binding |
| Uniprot ID | P0CF73 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 50
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1209875 | 1210174 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 2756956 | 2757255 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 2948071 | 2948370 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 3101882 | 3102181 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 1070375 | 1070674 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 6 | 3811260 | 3811559 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 7 | 315291 | 315590 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 8 | 566842 | 567141 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 9 | 2170236 | 2170535 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 10 | 1095138 | 1095437 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 11 | 392602 | 392901 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 12 | 5235398 | 5235697 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 13 | 3795893 | 3796192 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 14 | 5228758 | 5229057 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 15 | 828815 | 829114 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 16 | 2206693 | 2206992 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 17 | 4017009 | 4017308 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 18 | 2815005 | 2815304 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 19 | 4572727 | 4573026 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 20 | 2978507 | 2978806 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 21 | 1759259 | 1759558 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 22 | 3026737 | 3027036 | + | NZ_CP038498.1 | Pectobacterium punjabense |
| 23 | 3026386 | 3026673 | + | NZ_CP038498.1 | Pectobacterium punjabense |
| 24 | 1325633 | 1325932 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 25 | 2910685 | 2910984 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 26 | 115062 | 115361 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 27 | 2170527 | 2170826 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 28 | 802260 | 802556 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 29 | 4679544 | 4679843 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 30 | 926192 | 926491 | + | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 31 | 10919 | 11218 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 32 | 5037548 | 5037847 | + | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 33 | 2263668 | 2263967 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 34 | 4420533 | 4420802 | + | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 35 | 1834445 | 1834744 | + | NZ_LT615367.1 | Dickeya aquatica |
| 36 | 1831528 | 1831827 | - | NZ_LT615367.1 | Dickeya aquatica |
| 37 | 2688199 | 2688498 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 38 | 445518 | 445817 | + | NZ_CP038469.1 | Citrobacter tructae |
| 39 | 1747809 | 1748108 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 40 | 113038 | 113337 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 41 | 443946 | 444245 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 42 | 2771033 | 2771332 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 43 | 2328291 | 2328590 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 44 | 2317126 | 2317425 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 45 | 493614 | 493913 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 46 | 769656 | 769955 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 47 | 1166233 | 1166532 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 48 | 2619870 | 2620169 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 49 | 1540831 | 1541130 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 50 | 1723618 | 1723917 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 51 | 2616752 | 2617051 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 52 | 1393486 | 1393785 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 53 | 4744923 | 4745219 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 54 | 2965611 | 2965910 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 55 | 2737892 | 2738191 | + | NZ_CP011078.1 | Yersinia ruckeri |
| 56 | 9882 | 10181 | + | NZ_CP054057.1 | Scandinavium goeteborgense |
| 57 | 3922398 | 3922697 | - | NZ_CP042220.2 | Dickeya poaceiphila |
| 58 | 220547 | 220846 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 59 | 1645128 | 1645427 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 60 | 873823 | 874122 | + | NZ_CP025799.1 | Dickeya zeae |
| 61 | 452305 | 452604 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 62 | 5626173 | 5626472 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 63 | 3817504 | 3817803 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 64 | 1054092 | 1054391 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 65 | 4245252 | 4245545 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 66 | 4358415 | 4358714 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 67 | 4354063 | 4354362 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 68 | 62719 | 63003 | + | NZ_AP018688.1 | Vibrio rumoiensis |
| 69 | 434781 | 435065 | + | NZ_AP018685.1 | Vibrio rumoiensis |
| 70 | 1405946 | 1406230 | - | NZ_AP018685.1 | Vibrio rumoiensis |
| 71 | 1368865 | 1369149 | + | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 72 | 4888527 | 4888826 | - | NZ_CP014137.1 | Brenneria goodwinii |
| 73 | 2468957 | 2469241 | - | NZ_CP041660.1 | Catenovulum sediminis |
| 74 | 2550045 | 2550329 | - | NZ_CP041660.1 | Catenovulum sediminis |
| 75 | 1814353 | 1814637 | - | NZ_CP041660.1 | Catenovulum sediminis |
| 76 | 36296 | 36577 | + | NZ_CP040989.1 | Vibrio furnissii |
| 77 | 47498 | 47782 | + | NZ_CP040989.1 | Vibrio furnissii |
| 78 | 715760 | 716044 | - | NZ_CP041661.1 | Catenovulum sediminis |
| 79 | 119763 | 120047 | + | NZ_CP041661.1 | Catenovulum sediminis |
| 80 | 4538904 | 4539203 | - | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 81 | 4532432 | 4532731 | - | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 82 | 4475582 | 4475881 | - | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 83 | 341553 | 341852 | + | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 84 | 1464947 | 1465246 | + | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 85 | 3861737 | 3862018 | - | NZ_CP048602.1 | Halomonas piezotolerans |
| 86 | 3201450 | 3201731 | - | NZ_CP048602.1 | Halomonas piezotolerans |
| 87 | 2703720 | 2704001 | - | NZ_CP048602.1 | Halomonas piezotolerans |
| 88 | 3854417 | 3854698 | + | NZ_CP048602.1 | Halomonas piezotolerans |
| 89 | 3865570 | 3865851 | + | NZ_CP048602.1 | Halomonas piezotolerans |
| 90 | 458058 | 458339 | + | NZ_CP048602.1 | Halomonas piezotolerans |
| 91 | 101990 | 102274 | - | NZ_CP022359.1 | Shewanella bicestrii |
| 92 | 1765952 | 1766251 | + | NZ_CP021435.1 | Halomonas beimenensis |
| 93 | 514893 | 515192 | + | NZ_CP011835.1 | Azotobacter chroococcum |
| 94 | 1765296 | 1765577 | + | NZ_CP046268.1 | Vibrio spartinae |
| 95 | 1637643 | 1637942 | + | NC_012560.1 | Azotobacter vinelandii DJ |
| 96 | 2046355 | 2046654 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 97 | 4104384 | 4104689 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 98 | 4222281 | 4222586 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 99 | 932108 | 932413 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 100 | 4851757 | 4852071 | - | NZ_CP014476.1 | Methylomonas denitrificans |
| 101 | 567335 | 567649 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 102 | 637107 | 637421 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 103 | 4433173 | 4433487 | - | NZ_CP014476.1 | Methylomonas denitrificans |
| 104 | 816606 | 816920 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 105 | 988091 | 988405 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 106 | 4023430 | 4023744 | - | NZ_CP014476.1 | Methylomonas denitrificans |
| 107 | 1154441 | 1154755 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 108 | 2469950 | 2470264 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 109 | 1156274 | 1156588 | - | NZ_CP014476.1 | Methylomonas denitrificans |
| 110 | 4034496 | 4034810 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 111 | 4430119 | 4430433 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 112 | 4535568 | 4535882 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 113 | 2614676 | 2614963 | - | NZ_CP014476.1 | Methylomonas denitrificans |
| 114 | 2269762 | 2270076 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 115 | 3582808 | 3583104 | + | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 116 | 3272333 | 3272626 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 117 | 2256431 | 2256748 | - | NZ_CP072793.1 | Thiothrix unzii |
| 118 | 1403211 | 1403504 | + | NC_008789.1 | Halorhodospira halophila SL1 |
| 119 | 694574 | 694867 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 120 | 849729 | 850022 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 121 | 1688637 | 1688918 | - | NC_022664.1 | Spiribacter curvatus |
| 122 | 493115 | 493411 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004337.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13683.8 | 0.82 | 41 | -3.0 | same-strand | Integrase core domain |
| 2 | PF00665.28 | 0.84 | 42 | -3 | same-strand | Integrase core domain |
| 3 | PF13333.8 | 0.82 | 41 | -3.0 | same-strand | Integrase core domain |
| 4 | PF13276.8 | 0.76 | 38 | -3.0 | same-strand | HTH-like domain |
| 5 | PF13610.8 | 0.7 | 35 | -3 | same-strand | DDE domain |
++ More..