Result : P0CF06
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Insertion element IS1 protein InsA |
| NCBI Accession ID | AH003427.2 |
| Organism | Escherichia coli |
| Left | 3932 |
| Right | 4207 |
| Strand | + |
| Nucleotide Sequence | GTGGCTTCTGTTTCTATCAGCTGTCCCTCCTGTTCAGCTACTGACGGGGTGGTGCGTAACGGCAAAAGCACCGCCGGACATCAGCGCTATCTCTGCTCTCACTGCCGTAAAACATGGCAACTGCAGTTCACTTACACCGCTTCTCAACCCGGTACGCACCAGAAAATCATTGATATGGCCATGAATGGCGTTGGATGCCGGGCAACCGCCCGCATTATGGGCGTTGGCCTCAACACGATTTTCCGCCATTTAAAAAACTCAGGCCGCAGTCGGTAA |
| Sequence | MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTYTASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTIFRHLKNSGRSR |
| Source of smORF | Swiss-Prot |
| Function | Absolutely required for transposition of IS1. |
| Pubmed ID | 273224 15388431 16820486 17220406 |
| Domain | CDD:281762,CDD:289525 |
| Functional Category | Others |
| Uniprot ID | P0CF06 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 24
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 78302 | 78577 | + | NZ_CP041249.1 | Raoultella electrica |
| 2 | 282017 | 282292 | - | NZ_CP011601.1 | Phytobacter ursingii |
| 3 | 158988 | 159263 | - | NZ_CP061512.1 | Mixta calida |
| 4 | 161184 | 161459 | + | NZ_CP061512.1 | Mixta calida |
| 5 | 165231 | 165506 | - | NZ_CP041248.1 | Raoultella electrica |
| 6 | 167122 | 167397 | + | NZ_CP041248.1 | Raoultella electrica |
| 7 | 258123 | 258398 | - | NZ_CP041248.1 | Raoultella electrica |
| 8 | 4030508 | 4030783 | - | NZ_CP026377.1 | Mixta gaviniae |
| 9 | 2196942 | 2197217 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 10 | 1940715 | 1940990 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 11 | 86996 | 87271 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 12 | 4519497 | 4519772 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 13 | 4488829 | 4489104 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 14 | 4462691 | 4462966 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 15 | 148186 | 148461 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 16 | 4389492 | 4389767 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 17 | 4379196 | 4379471 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 18 | 4367372 | 4367647 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 19 | 266737 | 267012 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 20 | 4285417 | 4285692 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 21 | 378694 | 378969 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 22 | 3778404 | 3778679 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 23 | 3762286 | 3762561 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 24 | 3743460 | 3743735 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 25 | 3665598 | 3665873 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 26 | 3637768 | 3638043 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 27 | 3624671 | 3624946 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 28 | 984651 | 984926 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 29 | 3400808 | 3401083 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 30 | 3278049 | 3278324 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 31 | 1365522 | 1365797 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 32 | 1409936 | 1410211 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 33 | 3105967 | 3106242 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 34 | 3105198 | 3105473 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 35 | 3038967 | 3039242 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 36 | 1574204 | 1574479 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 37 | 1736029 | 1736304 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 38 | 1769087 | 1769362 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 39 | 1795184 | 1795459 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 40 | 1850104 | 1850379 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 41 | 1856042 | 1856317 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 42 | 1976735 | 1977010 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 43 | 2037210 | 2037485 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 44 | 2051128 | 2051403 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 45 | 2134703 | 2134978 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 46 | 2464519 | 2464794 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 47 | 2235289 | 2235564 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 48 | 2222541 | 2222816 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 49 | 2395690 | 2395965 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 50 | 2199207 | 2199482 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 51 | 2095478 | 2095753 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 52 | 1791641 | 1791916 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 53 | 1781351 | 1781626 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 54 | 1766966 | 1767241 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 55 | 1758816 | 1759091 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 56 | 2862895 | 2863170 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 57 | 2864696 | 2864971 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 58 | 1673810 | 1674085 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 59 | 1543204 | 1543479 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 60 | 1534054 | 1534329 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 61 | 1527117 | 1527392 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 62 | 1444718 | 1444993 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 63 | 3179745 | 3180020 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 64 | 3273826 | 3274101 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 65 | 1295511 | 1295786 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 66 | 3362023 | 3362298 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 67 | 1239920 | 1240195 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 68 | 1198073 | 1198348 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 69 | 3608563 | 3608838 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 70 | 3611150 | 3611425 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 71 | 985868 | 986143 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 72 | 3627283 | 3627558 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 73 | 3693163 | 3693438 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 74 | 3703235 | 3703510 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 75 | 3727876 | 3728151 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 76 | 3845255 | 3845530 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 77 | 3863654 | 3863929 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 78 | 3942889 | 3943164 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 79 | 623353 | 623628 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 80 | 4002954 | 4003229 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 81 | 558588 | 558863 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 82 | 4075909 | 4076184 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 83 | 479151 | 479426 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 84 | 4176618 | 4176893 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 85 | 4314292 | 4314567 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 86 | 4392704 | 4392979 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 87 | 4410243 | 4410518 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 88 | 4465110 | 4465385 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 89 | 4478039 | 4478314 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 90 | 4540565 | 4540840 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 91 | 19106 | 19381 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 92 | 278377 | 278652 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 93 | 307830 | 308105 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 94 | 3834924 | 3835199 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 95 | 2287883 | 2288158 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 96 | 520810 | 521085 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 97 | 3403395 | 3403670 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 98 | 1568246 | 1568521 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 99 | 3021902 | 3022177 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 100 | 3015071 | 3015346 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 101 | 2825639 | 2825914 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 102 | 2756140 | 2756415 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 103 | 2962748 | 2963023 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 104 | 4569778 | 4570053 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 105 | 1424321 | 1424596 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 106 | 867059 | 867334 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 107 | 4514925 | 4515200 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 108 | 2178230 | 2178505 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 109 | 4102752 | 4103027 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 110 | 1050010 | 1050285 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 111 | 1398936 | 1399211 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 112 | 4092046 | 4092321 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 113 | 3818443 | 3818718 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 114 | 2205606 | 2205881 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 115 | 3237824 | 3238099 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 116 | 273782 | 274057 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 117 | 2221071 | 2221346 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 118 | 3725519 | 3725794 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 119 | 466155 | 466430 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 120 | 3361023 | 3361298 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 121 | 3181636 | 3181935 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 122 | 1049833 | 1050108 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 123 | 291071 | 291346 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 124 | 279600 | 279875 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 125 | 1978940 | 1979215 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 126 | 3583483 | 3583758 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 127 | 258345 | 258620 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 128 | 20233 | 20508 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 129 | 4518527 | 4518802 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 130 | 5179089 | 5179364 | + | NZ_CP041247.1 | Raoultella electrica |
| 131 | 1002407 | 1002682 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 132 | 2406487 | 2406762 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 133 | 2827969 | 2828244 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 134 | 2560483 | 2560758 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 135 | 3353944 | 3354219 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 136 | 4336407 | 4336682 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 137 | 2100491 | 2100766 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 138 | 967079 | 967354 | - | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 139 | 3669219 | 3669494 | - | NZ_CP061511.1 | Mixta calida |
| 140 | 1451661 | 1451936 | - | NZ_CP061511.1 | Mixta calida |
| 141 | 2917113 | 2917388 | + | NZ_CP061511.1 | Mixta calida |
| 142 | 3028350 | 3028625 | + | NZ_CP061511.1 | Mixta calida |
| 143 | 3575181 | 3575456 | + | NZ_CP061511.1 | Mixta calida |
| 144 | 550381 | 550656 | + | NZ_CP061511.1 | Mixta calida |
| 145 | 3581458 | 3581733 | - | NZ_CP061511.1 | Mixta calida |
| 146 | 3357048 | 3357323 | - | NZ_CP061511.1 | Mixta calida |
| 147 | 3273823 | 3274098 | - | NZ_CP061511.1 | Mixta calida |
| 148 | 3095660 | 3095935 | - | NZ_CP061511.1 | Mixta calida |
| 149 | 1437182 | 1437457 | + | NZ_CP061511.1 | Mixta calida |
| 150 | 1455257 | 1455532 | + | NZ_CP061511.1 | Mixta calida |
| 151 | 2810062 | 2810337 | - | NZ_CP061511.1 | Mixta calida |
| 152 | 1898687 | 1898962 | + | NZ_CP061511.1 | Mixta calida |
| 153 | 2270238 | 2270513 | - | NZ_CP061511.1 | Mixta calida |
| 154 | 2251676 | 2251951 | - | NZ_CP061511.1 | Mixta calida |
| 155 | 2253698 | 2253973 | + | NZ_CP061511.1 | Mixta calida |
| 156 | 84394 | 84669 | - | NZ_CP061511.1 | Mixta calida |
| 157 | 4251482 | 4251757 | + | NZ_CP061511.1 | Mixta calida |
| 158 | 3157363 | 3157638 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 159 | 4304274 | 4304549 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 160 | 49879 | 50154 | + | NZ_CP036176.1 | Klebsiella huaxiensis |
| 161 | 1055064 | 1055339 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 162 | 4455990 | 4456265 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 163 | 3121241 | 3121516 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 164 | 4052086 | 4052361 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 165 | 5489308 | 5489583 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 166 | 3433 | 3708 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 167 | 29179 | 29454 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 168 | 4336003 | 4336278 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 169 | 152082 | 152357 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 170 | 4226945 | 4227220 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 171 | 4158506 | 4158781 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 172 | 234983 | 235258 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 173 | 4147173 | 4147448 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 174 | 265007 | 265282 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 175 | 4118719 | 4118994 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 176 | 4065538 | 4065813 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 177 | 4038536 | 4038811 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 178 | 4010727 | 4011002 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 179 | 406094 | 406369 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 180 | 3983953 | 3984228 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 181 | 3944624 | 3944899 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 182 | 3918540 | 3918815 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 183 | 3889280 | 3889555 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 184 | 3862057 | 3862332 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 185 | 533206 | 533481 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 186 | 560124 | 560399 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 187 | 3797063 | 3797338 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 188 | 3784779 | 3785054 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 189 | 615801 | 616076 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 190 | 619309 | 619584 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 191 | 3740381 | 3740656 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 192 | 759118 | 759393 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 193 | 3584597 | 3584872 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 194 | 3575805 | 3576080 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 195 | 845957 | 846232 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 196 | 3529326 | 3529601 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 197 | 870950 | 871225 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 198 | 890699 | 890974 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 199 | 951313 | 951588 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 200 | 966801 | 967076 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 201 | 3360598 | 3360873 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 202 | 3227218 | 3227493 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 203 | 3150998 | 3151273 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 204 | 1242844 | 1243119 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 205 | 1256830 | 1257105 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 206 | 1268947 | 1269222 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 207 | 3085633 | 3085908 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 208 | 1356819 | 1357094 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 209 | 3031119 | 3031394 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 210 | 2981145 | 2981420 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 211 | 2980370 | 2980645 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 212 | 2929607 | 2929882 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 213 | 1589975 | 1590250 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 214 | 1608182 | 1608457 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 215 | 1663366 | 1663641 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 216 | 2667828 | 2668103 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 217 | 2623599 | 2623874 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 218 | 2529875 | 2530150 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 219 | 2480650 | 2480925 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 220 | 1946091 | 1946366 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 221 | 2430968 | 2431243 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 222 | 2405883 | 2406158 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 223 | 2400999 | 2401274 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 224 | 2013671 | 2013946 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 225 | 2379482 | 2379757 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 226 | 2368056 | 2368331 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 227 | 2347840 | 2348115 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 228 | 2329132 | 2329407 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 229 | 2317645 | 2317920 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 230 | 2282338 | 2282613 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 231 | 2253899 | 2254174 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 232 | 2245775 | 2246050 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 233 | 2230027 | 2230302 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 234 | 2192562 | 2192837 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 235 | 2205438 | 2205713 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 236 | 2178535 | 2178810 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 237 | 2234382 | 2234657 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 238 | 2149670 | 2149945 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 239 | 2247371 | 2247646 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 240 | 2125483 | 2125758 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 241 | 2123200 | 2123475 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 242 | 2302102 | 2302377 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 243 | 2036978 | 2037253 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 244 | 2358045 | 2358320 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 245 | 2031448 | 2031723 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 246 | 2009192 | 2009467 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 247 | 1993605 | 1993880 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 248 | 2524625 | 2524900 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 249 | 1865251 | 1865526 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 250 | 1842879 | 1843154 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 251 | 1820960 | 1821235 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 252 | 2579778 | 2580053 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 253 | 2611056 | 2611331 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 254 | 2626676 | 2626951 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 255 | 2778728 | 2779003 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 256 | 2881673 | 2881948 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 257 | 1507091 | 1507366 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 258 | 2941500 | 2941775 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 259 | 1400116 | 1400391 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 260 | 2994250 | 2994525 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 261 | 3032726 | 3033001 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 262 | 1338506 | 1338781 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 263 | 3062966 | 3063241 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 264 | 3110976 | 3111251 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 265 | 3156679 | 3156954 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 266 | 3253704 | 3253979 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 267 | 3337711 | 3337986 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 268 | 3345649 | 3345924 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 269 | 3375213 | 3375488 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 270 | 3462573 | 3462848 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 271 | 3517750 | 3518025 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 272 | 3593462 | 3593737 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 273 | 728728 | 729003 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 274 | 3711254 | 3711529 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 275 | 646653 | 646928 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 276 | 3756982 | 3757257 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 277 | 3760041 | 3760316 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 278 | 3771992 | 3772267 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 279 | 3834323 | 3834598 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 280 | 551143 | 551418 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 281 | 526520 | 526795 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 282 | 3877691 | 3877966 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 283 | 3936611 | 3936886 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 284 | 4018555 | 4018830 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 285 | 333383 | 333658 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 286 | 4067134 | 4067409 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 287 | 287409 | 287684 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 288 | 4145466 | 4145741 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 289 | 223548 | 223823 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 290 | 151161 | 151436 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 291 | 92920 | 93195 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 292 | 4334426 | 4334701 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 293 | 41753 | 42028 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 294 | 4377004 | 4377279 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 295 | 3235402 | 3235677 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 296 | 3129319 | 3129594 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 297 | 3922484 | 3922759 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 298 | 2288064 | 2288339 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 299 | 2875772 | 2876047 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 300 | 3654073 | 3654348 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 301 | 3195757 | 3196032 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 302 | 3458166 | 3458441 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 303 | 2913693 | 2913968 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 304 | 3403885 | 3404160 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 305 | 3508573 | 3508848 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 306 | 2543576 | 2543851 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 307 | 1046833 | 1047108 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 308 | 1359261 | 1359536 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 309 | 768555 | 768830 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 310 | 1412473 | 1412748 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 311 | 2624726 | 2625001 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 312 | 4012425 | 4012700 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 313 | 1675191 | 1675466 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 314 | 2686337 | 2686612 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 315 | 1664859 | 1665134 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 316 | 744159 | 744434 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 317 | 544808 | 545083 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 318 | 3954984 | 3955259 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 319 | 1693048 | 1693323 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 320 | 2077682 | 2077957 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 321 | 3793680 | 3793955 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 322 | 1671834 | 1672133 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 323 | 3689213 | 3689437 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 324 | 411138 | 411362 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 325 | 3141013 | 3141237 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 326 | 1333 | 1608 | + | NZ_CP061528.1 | Shigella dysenteriae |
| 327 | 1600978 | 1601253 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 328 | 5170021 | 5170296 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 329 | 4622858 | 4623133 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 330 | 5479 | 5754 | - | NZ_CP051549.1 | Phytobacter diazotrophicus |
| 331 | 178720 | 178995 | - | NC_004851.1 | Shigella flexneri 2a str. 301 |
| 332 | 49640 | 49864 | + | NC_004851.1 | Shigella flexneri 2a str. 301 |
| 333 | 38705 | 38980 | + | NC_004851.1 | Shigella flexneri 2a str. 301 |
| 334 | 1428264 | 1428539 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 335 | 117131 | 117430 | + | NZ_CP026049.1 | Raoultella planticola |
| 336 | 179609 | 179887 | + | NZ_CP026049.1 | Raoultella planticola |
| 337 | 208863 | 209162 | - | NZ_CP011600.1 | Phytobacter ursingii |
| 338 | 150287 | 150511 | - | NZ_CP011600.1 | Phytobacter ursingii |
| 339 | 2717813 | 2718088 | + | NZ_CP015581.1 | Tatumella citrea |
| 340 | 9544 | 9819 | + | NC_016846.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 341 | 106031 | 106306 | + | NZ_CP048797.1 | Providencia vermicola |
| 342 | 5493141 | 5493365 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 343 | 5389558 | 5389782 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 344 | 4197006 | 4197230 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 345 | 1536521 | 1536745 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 346 | 2122482 | 2122706 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 347 | 2710633 | 2710857 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 348 | 362475 | 362699 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 349 | 63643 | 63867 | - | NZ_CP041250.1 | Raoultella electrica |
| 350 | 307543 | 307818 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 351 | 3491879 | 3492154 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 352 | 3122531 | 3122806 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 353 | 1830880 | 1831155 | + | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 354 | 3632532 | 3632807 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 355 | 2771227 | 2771532 | + | NZ_CP016176.1 | Xenorhabdus hominickii |
| 356 | 3444280 | 3444549 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 357 | 1717062 | 1717349 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 358 | 1499462 | 1499749 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 359 | 2262124 | 2262411 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 360 | 1876921 | 1877208 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 361 | 2132480 | 2132767 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 362 | 2997341 | 2997628 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 363 | 2449352 | 2449639 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 364 | 13208 | 13495 | + | NZ_CP006570.1 | Sodalis praecaptivus |
| 365 | 31137 | 31412 | - | NZ_CP032488.1 | Yersinia hibernica |
| 366 | 12067 | 12342 | - | NZ_CP032488.1 | Yersinia hibernica |
| 367 | 2967 | 3242 | - | NZ_CP032488.1 | Yersinia hibernica |
| 368 | 134638 | 134913 | + | NZ_CP032487.1 | Yersinia hibernica |
| 369 | 210162 | 210437 | + | NZ_CP032487.1 | Yersinia hibernica |
| 370 | 4018927 | 4019202 | - | NZ_CP032487.1 | Yersinia hibernica |
| 371 | 990975 | 991250 | + | NZ_CP032487.1 | Yersinia hibernica |
| 372 | 3711216 | 3711491 | - | NZ_CP032487.1 | Yersinia hibernica |
| 373 | 3700928 | 3701203 | - | NZ_CP032487.1 | Yersinia hibernica |
| 374 | 3496766 | 3497041 | - | NZ_CP032487.1 | Yersinia hibernica |
| 375 | 2990270 | 2990545 | - | NZ_CP032487.1 | Yersinia hibernica |
| 376 | 2631244 | 2631519 | + | NZ_CP032487.1 | Yersinia hibernica |
| 377 | 1991211 | 1991486 | - | NZ_CP032487.1 | Yersinia hibernica |
| 378 | 2972897 | 2973172 | + | NZ_CP032487.1 | Yersinia hibernica |
| 379 | 2991460 | 2991735 | + | NZ_CP032487.1 | Yersinia hibernica |
| 380 | 1562874 | 1563149 | - | NZ_CP032487.1 | Yersinia hibernica |
| 381 | 3610189 | 3610464 | + | NZ_CP032487.1 | Yersinia hibernica |
| 382 | 3948326 | 3948601 | + | NZ_CP032487.1 | Yersinia hibernica |
| 383 | 3958856 | 3959131 | + | NZ_CP032487.1 | Yersinia hibernica |
| 384 | 4037814 | 4038089 | + | NZ_CP032487.1 | Yersinia hibernica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP041249.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03400.15 | 0.62 | 15 | 27 | same-strand | IS1 transposase |
++ More..