Result : P0C8P9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Thiocillin GE37468 (Antibiotic GE37468) |
| NCBI Accession ID | JN052143.1 |
| Organism | Streptomyces sp. |
| Left | 7234 |
| Right | 7407 |
| Strand | + |
| Nucleotide Sequence | ATGGGGAACAACGAGGAGTACTTCATCGACGTCAACGACCTGTCGATCGACGTGTTCGACGTCGTGGAACAGGGCGGTGCCGTCACCGCGCTGACCGCCGATCACGGCATGCCCGAGGTCGGTGCGTCGACCAACTGCTTCTGCTACATCTGCTGCTCCTGCAGCTCCAACTGA |
| Sequence | MGNNEEYFIDVNDLSIDVFDVVEQGGAVTALTADHGMPEVGASTNCFCYICCSCSSN |
| Source of smORF | Swiss-Prot |
| Function | Has bacteriocidal activity against both aerobic and anaerobic Gram-positive bacteria. Inhibits growth of B.subtilis (MIC=0.047 ug/ml) and methicillin-resistant S.aureus (MRSA) (MIC=0.047 ug/ml). Has poor activity against Gram-negative bacteria, with the exception of B.fragilis. Inhibits bacterial protein biosynthesis by acting on elongation factor Tu (EF-Tu). Full antibiotic activity depends on the presence of the modified residue Ile-50. {ECO:0000269|Pubmed:21788474}. |
| Pubmed ID | 21788474 7592021 8557573 |
| Domain | CDD:380247 |
| Functional Category | Antimicrobial |
| Uniprot ID | P0C8P9 |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 264855 | 265028 | + | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 2 | 609854 | 610003 | + | NC_014165.1 | Thermobispora bispora DSM 43833 |
| 3 | 3333598 | 3333762 | + | NZ_CP047180.1 | Rathayibacter festucae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014165.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14028.8 | 0.67 | 2 | 4266.0 | same-strand | Lantibiotic biosynthesis dehydratase C-term |
| 2 | PF00440.25 | 0.67 | 2 | 298.5 | opposite-strand | Bacterial regulatory proteins, tetR family |
| 3 | PF00881.26 | 0.67 | 2 | 4322.5 | both-strands | Nitroreductase family |
++ More..