Protein Information |
Information Type | Description |
---|---|
Protein name | Thiocillin GE37468 (Antibiotic GE37468) |
NCBI Accession ID | JN052143.1 |
Organism | Streptomyces sp. |
Left | 7234 |
Right | 7407 |
Strand | + |
Nucleotide Sequence | ATGGGGAACAACGAGGAGTACTTCATCGACGTCAACGACCTGTCGATCGACGTGTTCGACGTCGTGGAACAGGGCGGTGCCGTCACCGCGCTGACCGCCGATCACGGCATGCCCGAGGTCGGTGCGTCGACCAACTGCTTCTGCTACATCTGCTGCTCCTGCAGCTCCAACTGA |
Sequence | MGNNEEYFIDVNDLSIDVFDVVEQGGAVTALTADHGMPEVGASTNCFCYICCSCSSN |
Source of smORF | Swiss-Prot |
Function | Has bacteriocidal activity against both aerobic and anaerobic Gram-positive bacteria. Inhibits growth of B.subtilis (MIC=0.047 ug/ml) and methicillin-resistant S.aureus (MRSA) (MIC=0.047 ug/ml). Has poor activity against Gram-negative bacteria, with the exception of B.fragilis. Inhibits bacterial protein biosynthesis by acting on elongation factor Tu (EF-Tu). Full antibiotic activity depends on the presence of the modified residue Ile-50. {ECO:0000269|Pubmed:21788474}. |
Pubmed ID | 21788474 7592021 8557573 |
Domain | CDD:380247 |
Functional Category | Antimicrobial |
Uniprot ID | P0C8P9 |
ORF Length (Amino Acid) | 57 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 264855 | 265028 | + | NZ_CP016279.1 | Streptomyces griseochromogenes |
2 | 609854 | 610003 | + | NC_014165.1 | Thermobispora bispora DSM 43833 |
3 | 3333598 | 3333762 | + | NZ_CP047180.1 | Rathayibacter festucae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF14028.8 | 0.67 | 2 | 4266.0 | same-strand | Lantibiotic biosynthesis dehydratase C-term |
2 | PF00440.25 | 0.67 | 2 | 298.5 | opposite-strand | Bacterial regulatory proteins, tetR family |
3 | PF00881.26 | 0.67 | 2 | 4322.5 | both-strands | Nitroreductase family |