Result : P0C8M5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Transcriptional regulator SlrA |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3923319 |
| Right | 3923477 |
| Strand | + |
| Nucleotide Sequence | ATGAAAACTCATGTTAAAAAAGATTTGGACAAAGGTTGGCATATGTTAATTCAAGAAGCTAGATCCATTGGATTAGGCATTCATGATGTGAGGCAGTTTTTAGAATCTGAGACAGCATCAAGAAAGAAAAACCACAAAAAAACCGTCCGGCAAGACTAG |
| Sequence | MKTHVKKDLDKGWHMLIQEARSIGLGIHDVRQFLESETASRKKNHKKTVRQD |
| Source of smORF | Swiss-Prot |
| Function | Required specifically for induction of eps and yqxM operons by antagonizing SinR. Regulates SlrR activity. Controls the initiation of biofilm formation. {ECO:0000269|Pubmed:18647168}. |
| Pubmed ID | 9384377 18647168 |
| Domain | CDD:400831 |
| Functional Category | Others |
| Uniprot ID | P0C8M5 |
| ORF Length (Amino Acid) | 52 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3923319 | 3923477 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3745417 | 3745575 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 3785350 | 3785508 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 2315789 | 2315947 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 3808783 | 3808941 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 3735738 | 3735896 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3748577 | 3748735 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 8 | 266117 | 266278 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3774879 | 3775040 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04226.15 | 0.89 | 8 | 4288.5 | same-strand | Transglycosylase associated protein |
| 2 | PF02744.19 | 1.0 | 9 | 2684 | opposite-strand | Galactose-1-phosphate uridyl transferase, C-terminal domain |
| 3 | PF01087.24 | 1.0 | 9 | 2684 | opposite-strand | Galactose-1-phosphate uridyl transferase, N-terminal domain |
| 4 | PF10509.11 | 0.89 | 8 | 1508.5 | opposite-strand | Galactokinase galactose-binding signature |
| 5 | PF00288.28 | 0.89 | 8 | 1508.5 | opposite-strand | GHMP kinases N terminal domain |
| 6 | PF04138.16 | 1.0 | 9 | 1021 | opposite-strand | GtrA-like protein |
| 7 | PF00440.25 | 1.0 | 9 | 353 | opposite-strand | Bacterial regulatory proteins, tetR family |
| 8 | PF04341.14 | 0.78 | 7 | 440 | same-strand | Protein of unknown function, DUF485 |
| 9 | PF00474.19 | 0.78 | 7 | 746 | same-strand | Sodium:solute symporter family |
| 10 | PF01323.22 | 1.0 | 9 | 2319 | opposite-strand | DSBA-like thioredoxin domain |
| 11 | PF13743.8 | 0.67 | 6 | 2319.0 | opposite-strand | Thioredoxin |
| 12 | PF04261.14 | 1.0 | 9 | 3010 | opposite-strand | Dyp-type peroxidase family |
| 13 | PF10518.11 | 1.0 | 9 | 3010 | opposite-strand | TAT (twin-arginine translocation) pathway signal sequence |
++ More..