Result : A4VZ14
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Nucleoid-associated protein SSU98_0195 |
| NCBI Accession ID | CP000408.1 |
| Organism | Streptococcus suis (strain 98HAH33) |
| Left | 180200 |
| Right | 180499 |
| Strand | - |
| Nucleotide Sequence | ATGATGAACATGCAAAACATGATGCGCCAAGCTCAAAAACTTCAAAAACAAATGGAGAAGAGTCAAGCTGAGTTGGCTGCTACTCAATTTACTGGTAGCTCTGTACAAGACTTGGTTACTGCTACTTTTACTGGAGATAAGAAATTGGTTTCTATCGACTTCAAGGCTGATGTTGTGGATGCAGACGACCTTGAAACCTTGCAAGAAATGACAATCCAAGCCGTCAACGCTGCACTTACAAAAGTTGACGAGGCAACTCAGAAAAAACTAGGTGCCTTTGCAGGTAAATTACCTTTTTAA |
| Sequence | MMNMQNMMRQAQKLQKQMEKSQAELAATQFTGSSVQDLVTATFTGDKKLVSIDFKADVVDADDLETLQEMTIQAVNAALTKVDEATQKKLGAFAGKLPF |
| Source of smORF | Swiss-Prot |
| Function | Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection. {ECO:0000255|HAMAP-Rule:MF_00274}. |
| Pubmed ID | 17375201 |
| Domain | CDD:412410 |
| Functional Category | DNA-binding |
| Uniprot ID | A4VZ14 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 50
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 180285 | 180584 | - | NC_012924.1 | Streptococcus suis SC84 |
| 2 | 188514 | 188813 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 3 | 806872 | 807171 | - | NZ_CP016953.1 | Streptococcus himalayensis |
| 4 | 246975 | 247274 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 5 | 980118 | 980366 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 6 | 153040 | 153339 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 7 | 205825 | 206124 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 8 | 180301 | 180600 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 9 | 233574 | 233834 | - | NZ_CP022680.1 | Streptococcus respiraculi |
| 10 | 1598842 | 1599141 | + | NZ_LS483343.1 | Streptococcus ferus |
| 11 | 1862466 | 1862714 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 12 | 854782 | 855030 | - | NZ_LR134293.1 | Streptococcus canis |
| 13 | 2365404 | 2365685 | - | NZ_LT906439.1 | Streptococcus merionis |
| 14 | 1482308 | 1482589 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 15 | 1690155 | 1690436 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 16 | 858915 | 859163 | + | NZ_CP032620.1 | Streptococcus koreensis |
| 17 | 1547842 | 1548123 | + | NZ_LS483403.1 | Streptococcus lutetiensis |
| 18 | 1908691 | 1908972 | + | NZ_CP039457.1 | Streptococcus pasteurianus |
| 19 | 713888 | 714136 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 20 | 1027267 | 1027515 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 21 | 821316 | 821564 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 22 | 238424 | 238672 | + | NZ_CP043405.1 | Streptococcus ratti |
| 23 | 1726856 | 1727104 | + | NZ_AP014612.1 | Streptococcus troglodytae |
| 24 | 1731452 | 1731733 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 25 | 1470126 | 1470374 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 26 | 1560016 | 1560297 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 27 | 516541 | 516822 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 28 | 1250632 | 1250913 | + | NZ_CP013237.1 | Streptococcus mutans |
| 29 | 1729645 | 1729893 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 30 | 1537164 | 1537445 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 31 | 296637 | 296885 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 32 | 374908 | 375156 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 33 | 1831786 | 1832067 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 34 | 1795637 | 1795918 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 35 | 290572 | 290871 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 36 | 99235 | 99534 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 37 | 1882114 | 1882395 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 38 | 2253575 | 2253874 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 39 | 3645015 | 3645317 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 40 | 1706567 | 1706848 | + | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 41 | 1451955 | 1452254 | - | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 42 | 1825415 | 1825663 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 43 | 241336 | 241617 | + | NZ_CP065637.1 | Lactococcus garvieae |
| 44 | 1423260 | 1423508 | - | NZ_CP017326.1 | Weissella soli |
| 45 | 727443 | 727724 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 46 | 387474 | 387755 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 47 | 1761762 | 1762043 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 48 | 1299097 | 1299399 | + | NZ_CP049889.1 | Jeotgalibaca porci |
| 49 | 1753714 | 1754016 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 50 | 1285773 | 1286072 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
++ More..