Result : P0C079
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin RelB |
| NCBI Accession ID | X02405.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 494 |
| Right | 733 |
| Strand | + |
| Nucleotide Sequence | ATGGGTAGCATTAACCTGCGTATTGACGATGAACTTAAAGCGCGTTCTTACGCCGCGCTTGAAAAAATGGGTGTAACTCCTTCTGAAGCGCTTCGTCTCATGCTCGAGTATATCGCTGACAATGAACGCTTGCCGTTCAAACAGACACTCCTGAGTGATGAAGATGCTGAACTTGTGGAGATAGTGAAAGAACGGCTTCGTAATCCTAAGCCAGTACGTGTGACGCTGGATGAACTCTGA |
| Sequence | MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Counteracts the effect of cognate toxin RelE via direct protein-protein interaction, preventing RelE from entering the ribosome A site and thus inhibiting its endoribonuclease activity. An autorepressor of relBE operon transcription. 2 RelB dimers bind to 2 operator sequences; DNA-binding and repression is stronger when complexed with toxin/corepressor RelE by conditional cooperativity (Pubmed:18501926, Pubmed:22981948). Increased transcription rate of relBE and activation of relE is consistent with a lower level of RelB in starved cells due to degradation of RelB by protease Lon. {ECO:0000269|Pubmed:11274135, ECO:0000269|Pubmed:11717402, ECO:0000269|Pubmed:12123459, ECO:0000269|Pubmed:18501926, ECO:0000269|Pubmed:18532983, ECO:0000269|Pubmed:19707553, ECO:0000269|Pubmed:19747491, ECO:0000269|Pubmed:22210768, ECO:0000269|Pubmed:22981948, ECO:0000269|Pubmed:9767574}.; Seems to be a principal mediator of cell death in liquid media. {ECO:0000269|Pubmed:19707553}. |
| Pubmed ID | 2990907 9097039 9278503 16738553 9767574 11274135 11717402 12123459 18532983 19747491 20005847 19707553 22210768 23432955 18501926 19297318 22981948 |
| Domain | CDD:412776 |
| Functional Category | Antitoxin_type_2_and_DNA-binding |
| Uniprot ID | P0C079 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 36
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 91413 | 91652 | + | NZ_CP033743.1 | Citrobacter freundii |
| 2 | 26171 | 26410 | - | NZ_CP011601.1 | Phytobacter ursingii |
| 3 | 240749 | 240988 | - | NZ_CP061512.1 | Mixta calida |
| 4 | 1581986 | 1582225 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 1645633 | 1645872 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 6 | 2894119 | 2894358 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 7 | 1492938 | 1493177 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 8 | 59057 | 59296 | - | NZ_CP011600.1 | Phytobacter ursingii |
| 9 | 2721736 | 2721975 | + | NZ_CP050508.1 | Raoultella terrigena |
| 10 | 115457 | 115696 | - | NZ_CP034150.1 | Pantoea agglomerans |
| 11 | 721487 | 721726 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 12 | 3421366 | 3421605 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 13 | 5312604 | 5312846 | + | NZ_CP014782.1 | Shewanella psychrophila |
| 14 | 6063482 | 6063721 | + | NZ_CP014870.1 | Pseudomonas silesiensis |
| 15 | 3991152 | 3991391 | + | NZ_CP009365.1 | Pseudomonas soli |
| 16 | 1568455 | 1568694 | - | NZ_CP027723.1 | Pseudomonas orientalis |
| 17 | 5242083 | 5242322 | + | NZ_CP049044.1 | Pseudomonas psychrophila |
| 18 | 5811575 | 5811814 | - | NZ_CP042804.1 | Pseudomonas amygdali pv. tabaci str. ATCC 11528 |
| 19 | 6119310 | 6119549 | - | NC_004578.1 | Pseudomonas syringae pv. tomato str. DC3000 |
| 20 | 4052058 | 4052300 | + | NC_015554.1 | Alteromonas naphthalenivorans |
| 21 | 5760986 | 5761225 | - | NZ_CP068034.2 | Pseudomonas syringae |
| 22 | 1996427 | 1996669 | + | NZ_LR134167.1 | Avibacterium volantium |
| 23 | 4540591 | 4540830 | - | NZ_CP022562.1 | Pseudomonas monteilii |
| 24 | 2216945 | 2217184 | - | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 25 | 1790646 | 1790885 | - | NZ_CP027756.1 | Pseudomonas synxantha |
| 26 | 4955094 | 4955333 | + | NC_008027.1 | Pseudomonas entomophila L48 |
| 27 | 317078 | 317317 | - | NZ_CP060009.1 | Pseudomonas sediminis |
| 28 | 374218 | 374457 | + | NZ_CP056030.1 | Pseudomonas eucalypticola |
| 29 | 5429806 | 5430045 | - | NZ_CP071706.1 | Pseudomonas donghuensis |
| 30 | 816617 | 816859 | + | NZ_CP030241.1 | Moraxella bovis |
| 31 | 2721518 | 2721760 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 32 | 2729167 | 2729409 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 33 | 533355 | 533597 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 34 | 525706 | 525948 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 35 | 5420477 | 5420719 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 36 | 4696000 | 4696242 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 37 | 523291 | 523533 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 38 | 4030193 | 4030435 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 39 | 303789 | 304028 | - | NZ_CP045303.1 | Azotobacter salinestris |
| 40 | 582622 | 582861 | - | NZ_AP021889.1 | Thiosulfatimonas sediminis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033743.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05016.17 | 0.81 | 29 | -10.0 | same-strand | ParE toxin of type II toxin-antitoxin system, parDE |
| 2 | PF15781.7 | 0.64 | 23 | -10.0 | same-strand | ParE-like toxin of type II bacterial toxin-antitoxin system |
++ More..