Result : P0AFV8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phage shock protein D |
| NCBI Accession ID | X57560.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 1812 |
| Right | 2033 |
| Strand | + |
| Nucleotide Sequence | ATGAATACTCGCTGGCAACAGGCCGGGCAAAAGGTAAAGCCTGGTTTCAAATTAGCAGGCAAGCTGGTACTTCTTACCGCACTGCGCTATGGCCCGGCGGGTGTGGCGGGCTGGGCGATAAAATCAGTTGCTCGCCGACCGCTGAAAATGTTGCTGGCTGTGGCGCTGGAACCGCTGTTAAGTCGGGCTGCTAATAAACTGGCACAGCGTTATAAAAGGTGA |
| Sequence | MNTRWQQAGQKVKPGFKLAGKLVLLTALRYGPAGVAGWAIKSVARRPLKMLLAVALEPLLSRAANKLAQRYKR |
| Source of smORF | Swiss-Prot |
| Function | The phage shock protein (psp) operon (pspABCDE) may play a significant role in the competition for survival under nutrient- or energy-limited conditions. {ECO:0000269|Pubmed:1712397}. |
| Pubmed ID | 1712397 9097039 9278503 16738553 12562786 |
| Domain | CDD:421368 |
| Functional Category | Others |
| Uniprot ID | P0AFV8 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 67
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1840554 | 1840775 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 1369393 | 1369614 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1877349 | 1877570 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 2368851 | 2369072 | - | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 1363540 | 1363761 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 6 | 1432650 | 1432871 | + | NZ_AP014857.1 | Escherichia albertii |
| 7 | 1780857 | 1781075 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 8 | 688999 | 689220 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 9 | 4719387 | 4719617 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 10 | 352087 | 352317 | - | NZ_CP033744.1 | Citrobacter freundii |
| 11 | 4043744 | 4043962 | + | NZ_CP026047.1 | Raoultella planticola |
| 12 | 3178929 | 3179147 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 13 | 2245269 | 2245487 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 14 | 2999474 | 2999692 | - | NZ_CP041247.1 | Raoultella electrica |
| 15 | 3283405 | 3283623 | - | NZ_CP050508.1 | Raoultella terrigena |
| 16 | 3967952 | 3968176 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 17 | 2990731 | 2990955 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 18 | 2072451 | 2072672 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 19 | 3483377 | 3483607 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 20 | 2511172 | 2511393 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 21 | 2560393 | 2560617 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 22 | 3345095 | 3345325 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 23 | 2514381 | 2514605 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 24 | 2948383 | 2948601 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 25 | 2257038 | 2257256 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 26 | 3134708 | 3134926 | - | NZ_CP054254.1 | Klebsiella variicola |
| 27 | 2547490 | 2547711 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 28 | 2527660 | 2527878 | - | NC_015968.1 | Enterobacter soli |
| 29 | 442978 | 443196 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 30 | 4710556 | 4710780 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 31 | 2774086 | 2774310 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 32 | 1374089 | 1374310 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 33 | 2559535 | 2559759 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 34 | 889847 | 890068 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 35 | 3295631 | 3295849 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 36 | 2528102 | 2528320 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 37 | 1346987 | 1347208 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 38 | 2539329 | 2539565 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 39 | 2649648 | 2649884 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 40 | 2256607 | 2256849 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 41 | 2573142 | 2573378 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 42 | 4239133 | 4239363 | - | NZ_CP053416.1 | Salmonella bongori |
| 43 | 3007957 | 3008175 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 44 | 546038 | 546274 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 45 | 1112474 | 1112704 | - | NZ_CP038469.1 | Citrobacter tructae |
| 46 | 493965 | 494201 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 47 | 2361745 | 2361987 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 48 | 2009335 | 2009553 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 49 | 4116861 | 4117085 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 50 | 1813266 | 1813490 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 51 | 2124425 | 2124643 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 52 | 2360051 | 2360293 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 53 | 2293729 | 2293971 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 54 | 1661355 | 1661597 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 55 | 1862467 | 1862709 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 56 | 2194175 | 2194405 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 57 | 1091395 | 1091637 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 58 | 4062355 | 4062567 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 59 | 1718421 | 1718642 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 60 | 2038013 | 2038261 | - | NZ_LN907827.1 | Erwinia gerundensis |
| 61 | 2099643 | 2099843 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 62 | 1969238 | 1969438 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 63 | 1959329 | 1959529 | + | NZ_CP038853.1 | Pantoea vagans |
| 64 | 1887876 | 1888106 | - | NZ_LR134201.1 | Cedecea lapagei |
| 65 | 2190064 | 2190294 | + | NZ_CP023525.1 | Cedecea neteri |
| 66 | 2610750 | 2610932 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 67 | 2254958 | 2255158 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 68 | 560676 | 560876 | - | NZ_CP049115.1 | Pantoea stewartii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061527.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00158.28 | 1.0 | 67 | 1531.0 | opposite-strand | Sigma-54 interaction domain |
| 2 | PF14532.8 | 1.0 | 67 | 1531.0 | opposite-strand | Sigma-54 interaction domain |
| 3 | PF07728.16 | 1.0 | 67 | 1497 | opposite-strand | AAA domain (dynein-related subfamily) |
| 4 | PF02954.21 | 0.99 | 66 | 1494 | opposite-strand | Bacterial regulatory protein, Fis family |
| 5 | PF04012.14 | 1.0 | 67 | 656.5 | same-strand | PspA/IM30 family |
| 6 | PF06667.14 | 1.0 | 67 | 378.0 | same-strand | Phage shock protein B |
| 7 | PF04024.14 | 1.0 | 67 | 19.0 | same-strand | PspC domain |
++ More..