| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Endoribonuclease antitoxin GhoS (EC 3.1.-.-) (Antitoxin GhoS) |
| NCBI Accession ID | U14003.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 43412 |
| Right | 43708 |
| Strand | + |
| Nucleotide Sequence | ATGGAAGGTAAAAACAAGTTCAATACTTATGTTGTTTCTTTTGATTATCCATCATCTTATTCCTCAGTGTTCTTAAGATTAAGATCATTGATGTATGATATGAATTTCTCCTCTATCGTGGCTGATGAATATGGGATACCACGACAATTGAATGAAAACTCCTTCGCAATAACGACATCGTTAGCCGCAAGTGAAATCGAAGATTTAATCAGGCTCAAATGCTTAGACTTACCGGATATTGATTTTGACCTCAACATTATGACAGTTGATGACTATTTCCGTCAGTTTTACAAGTAG |
| Sequence | MEGKNKFNTYVVSFDYPSSYSSVFLRLRSLMYDMNFSSIVADEYGIPRQLNENSFAITTSLAASEIEDLIRLKCLDLPDIDFDLNIMTVDDYFRQFYK |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type V toxin-antitoxin (TA) system. Neutralizes the toxic effects of toxin GhoT by digesting ghoT transcripts in a sequence-specific manner (Pubmed:22941047). In concert with GhoT is involved in reducing cell growth during antibacterial stress (Pubmed:24373067). Overexpression leads to transcript level reduction of 20 other mRNAs involved in purine or pyrimidine synthesis and transport. Not seen to bind its own promoter DNA (Pubmed:22941047). {ECO:0000269|Pubmed:22941047, ECO:0000269|Pubmed:24373067}. |
| Pubmed ID | 7610040 9278503 16738553 23289863 24373067 24797297 22941047 |
| Domain | CDD:402595 |
| Functional Category | Others |
| Uniprot ID | P0AF61 |
| ORF Length (Amino Acid) | 98 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4352584 | 4352880 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 5207161 | 5207457 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 378572 | 378868 | + | NZ_LR134340.1 | Escherichia marmotae |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03605.16 | 1.0 | 2 | 3840 | opposite-strand | Anaerobic c4-dicarboxylate membrane transporter |
| 2 | PF00072.26 | 1.0 | 2 | 2550 | opposite-strand | Response regulator receiver domain |
| 3 | PF17203.6 | 1.0 | 2 | 922 | opposite-strand | Single cache domain 3 |
| 4 | PF02518.28 | 1.0 | 2 | 922 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 5 | PF00989.27 | 1.0 | 2 | 922 | opposite-strand | PAS fold |
| 6 | PF14501.8 | 1.0 | 2 | 922 | opposite-strand | GHKL domain |
| 7 | PF13596.8 | 1.0 | 2 | 922 | opposite-strand | PAS domain |
| 8 | PF13426.9 | 1.0 | 2 | 922 | opposite-strand | PAS domain |
| 9 | PF06902.13 | 1.0 | 2 | 511 | same-strand | Divergent 4Fe-4S mono-cluster |
| 10 | PF14542.8 | 1.0 | 2 | 227 | same-strand | GCN5-related N-acetyl-transferase |
| 11 | PF10753.11 | 1.0 | 2 | 28 | same-strand | Toxin GhoT OrtT |
| 12 | PF00152.22 | 1.0 | 2 | 320 | opposite-strand | tRNA synthetases class II (D, K and N) |
| 13 | PF01336.27 | 1.0 | 2 | 320 | opposite-strand | OB-fold nucleic acid binding domain |
| 14 | PF00854.23 | 1.0 | 2 | 2074 | opposite-strand | POT family |
| 15 | PF07690.18 | 1.0 | 2 | 2074 | opposite-strand | Major Facilitator Superfamily |
| 16 | PF01276.22 | 1.0 | 2 | 3590 | opposite-strand | Orn/Lys/Arg decarboxylase, major domain |
| 17 | PF03711.17 | 1.0 | 2 | 3590 | opposite-strand | Orn/Lys/Arg decarboxylase, C-terminal domain |
| 18 | PF03709.17 | 1.0 | 2 | 3590 | opposite-strand | Orn/Lys/Arg decarboxylase, N-terminal domain |
| 19 | PF13520.8 | 1.0 | 2 | 5817 | opposite-strand | Amino acid permease |