Result : P0AF61

Protein Information

• Protein name: Endoribonuclease antitoxin GhoS (EC 3.1.-.-) (Antitoxin GhoS)
• NCBI Accession ID: U14003.1
• Organism: Escherichia coli (strain K12)
• Left: 43412
• Right: 43708
• Strand: +
• Nucleotide Sequence: ATGGAAGGTAAAAACAAGTTCAATACTTATGTTGTTTCTTTTGATTATCCATCATCTTATTCCTCAGTGTTCTTAAGATTAAGATCATTGATGTATGATATGAATTTCTCCTCTATCGTGGCTGATGAATATGGGATACCACGACAATTGAATGAAAACTCCTTCGCAATAACGACATCGTTAGCCGCAAGTGAAATCGAAGATTTAATCAGGCTCAAATGCTTAGACTTACCGGATATTGATTTTGACCTCAACATTATGACAGTTGATGACTATTTCCGTCAGTTTTACAAGTAG
• Sequence: MEGKNKFNTYVVSFDYPSSYSSVFLRLRSLMYDMNFSSIVADEYGIPRQLNENSFAITTSLAASEIEDLIRLKCLDLPDIDFDLNIMTVDDYFRQFYK
• Source of smORF: Swiss-Prot
• Function: Antitoxin component of a type V toxin-antitoxin (TA) system. Neutralizes the toxic effects of toxin GhoT by digesting ghoT transcripts in a sequence-specific manner (Pubmed:22941047). In concert with GhoT is involved in reducing cell growth during antibacterial stress (Pubmed:24373067). Overexpression leads to transcript level reduction of 20 other mRNAs involved in purine or pyrimidine synthesis and transport. Not seen to bind its own promoter DNA (Pubmed:22941047). {ECO:0000269|Pubmed:22941047, ECO:0000269|Pubmed:24373067}.
• Pubmed ID: 7610040 9278503 16738553 23289863 24373067 24797297 22941047
• Domain: CDD:402595
• Functional Category: Others
• Uniprot ID: P0AF61
• ORF Length (Amino Acid): 98

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	4352584	4352880	+	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
2	5207161	5207457	+	NC_002695.2	Escherichia coli O157:H7 str. Sakai
3	378572	378868	+	NZ_LR134340.1	Escherichia marmotae

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000913.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF03605.16	1.0	2	3840	opposite-strand	Anaerobic c4-dicarboxylate membrane transporter
2	PF00072.26	1.0	2	2550	opposite-strand	Response regulator receiver domain
3	PF17203.6	1.0	2	922	opposite-strand	Single cache domain 3
4	PF02518.28	1.0	2	922	opposite-strand	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
5	PF00989.27	1.0	2	922	opposite-strand	PAS fold
6	PF14501.8	1.0	2	922	opposite-strand	GHKL domain
7	PF13596.8	1.0	2	922	opposite-strand	PAS domain
8	PF13426.9	1.0	2	922	opposite-strand	PAS domain
9	PF06902.13	1.0	2	511	same-strand	Divergent 4Fe-4S mono-cluster
10	PF14542.8	1.0	2	227	same-strand	GCN5-related N-acetyl-transferase
11	PF10753.11	1.0	2	28	same-strand	Toxin GhoT OrtT
12	PF00152.22	1.0	2	320	opposite-strand	tRNA synthetases class II (D, K and N)
13	PF01336.27	1.0	2	320	opposite-strand	OB-fold nucleic acid binding domain
14	PF00854.23	1.0	2	2074	opposite-strand	POT family
15	PF07690.18	1.0	2	2074	opposite-strand	Major Facilitator Superfamily
16	PF01276.22	1.0	2	3590	opposite-strand	Orn/Lys/Arg decarboxylase, major domain
17	PF03711.17	1.0	2	3590	opposite-strand	Orn/Lys/Arg decarboxylase, C-terminal domain
18	PF03709.17	1.0	2	3590	opposite-strand	Orn/Lys/Arg decarboxylase, N-terminal domain
19	PF13520.8	1.0	2	5817	opposite-strand	Amino acid permease