Result : P0AF59
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YjdI |
| NCBI Accession ID | U14003.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 42671 |
| Right | 42901 |
| Strand | + |
| Nucleotide Sequence | ATGGATCAGGCGCTACTGGACGGGGGTTATCGCTGTTATACCGGCGAAAAGATCGATGTCTATTTCAACACTGCGATATGTCAGCATTCTGGCAATTGCGTACGTGGCAACGGCAAGTTATTTAATCTCAAACGAAAGCCGTGGATCATGCCGGATGAAGTCGACGTCGCCACTGTGGTTAAAGTGATTGATACGTGCCCGAGCGGCGCGCTGAAATACCGTCATAAATAA |
| Sequence | MDQALLDGGYRCYTGEKIDVYFNTAICQHSGNCVRGNGKLFNLKRKPWIMPDEVDVATVVKVIDTCPSGALKYRHK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl19102. Profile Description: 4Fe-4S dicluster domain. Domain II of the enzyme dihydroprymidine dehydrogenase binds FAD. Dihydroprymidine dehydrogenase catalyzes the first and rate-limiting step of pyrimidine degradation by converting pyrimidines to the corresponding 5,6- dihydro compounds. This domain carries two Fe4-S4 clusters. |
| Pubmed ID | 7610040 9278503 16738553 |
| Domain | CDD:418523 |
| Functional Category | Others |
| Uniprot ID | P0AF59 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 61
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4351843 | 4352073 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 5206420 | 5206650 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 4014354 | 4014584 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 377830 | 378060 | + | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 835513 | 835743 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 6 | 841918 | 842148 | + | NZ_CP054254.1 | Klebsiella variicola |
| 7 | 1031857 | 1032087 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 8 | 889981 | 890211 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 9 | 3985125 | 3985355 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 10 | 4014444 | 4014674 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 11 | 4400455 | 4400685 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 12 | 861097 | 861330 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 13 | 3310701 | 3310931 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 14 | 3935309 | 3935539 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 15 | 4279334 | 4279564 | + | NZ_CP038469.1 | Citrobacter tructae |
| 16 | 944827 | 945057 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 17 | 1789776 | 1790006 | - | NZ_CP033744.1 | Citrobacter freundii |
| 18 | 801502 | 801732 | - | NZ_CP026047.1 | Raoultella planticola |
| 19 | 885310 | 885540 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 20 | 826333 | 826563 | + | NZ_CP041247.1 | Raoultella electrica |
| 21 | 1488786 | 1489016 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 22 | 4300782 | 4301012 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 23 | 3921747 | 3921977 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 24 | 887481 | 887711 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 25 | 3828471 | 3828701 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 26 | 3450439 | 3450669 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 27 | 4556026 | 4556256 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 28 | 228794 | 229024 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 29 | 3825169 | 3825399 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 30 | 4132159 | 4132389 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 31 | 3205576 | 3205806 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 32 | 3825333 | 3825563 | - | NC_015968.1 | Enterobacter soli |
| 33 | 882480 | 882710 | + | NZ_CP050508.1 | Raoultella terrigena |
| 34 | 884149 | 884379 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 35 | 3963189 | 3963419 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 36 | 3771819 | 3772049 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 37 | 1565554 | 1565784 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 38 | 5083887 | 5084117 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 39 | 3074855 | 3075085 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 40 | 4562919 | 4563149 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 41 | 3543346 | 3543576 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 42 | 2272152 | 2272382 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 43 | 957406 | 957651 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 44 | 1852220 | 1852450 | - | NZ_CP050150.1 | Hafnia alvei |
| 45 | 4360053 | 4360283 | + | NZ_AP014857.1 | Escherichia albertii |
| 46 | 1061752 | 1061982 | + | NZ_CP071320.1 | Serratia ureilytica |
| 47 | 3346142 | 3346372 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 48 | 1578167 | 1578397 | - | NZ_LR134531.1 | Pragia fontium |
| 49 | 4040745 | 4040987 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 50 | 181144 | 181377 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 51 | 123801 | 124019 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 52 | 136469 | 136702 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 53 | 117277 | 117510 | + | NZ_LT906444.1 | Listeria welshimeri |
| 54 | 601441 | 601668 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 55 | 1181738 | 1181977 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 56 | 127197 | 127427 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 57 | 1964310 | 1964549 | - | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 58 | 244936 | 245166 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 59 | 623969 | 624238 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 60 | 2112199 | 2112435 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 61 | 2794043 | 2794258 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 62 | 1389274 | 1389510 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14542.8 | 0.98 | 60 | 12 | same-strand | GCN5-related N-acetyl-transferase |
++ More..