Result : P0AEL3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Fe(2+) transport protein A (Ferrous iron transport protein A) |
| NCBI Accession ID | X71063.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 334 |
| Right | 561 |
| Strand | + |
| Nucleotide Sequence | ATGCAATACACTCCAGATACTGCGTGGAAAATCACTGGCTTTTCCCGTGAAATCAGCCCGGCATATCGCCAAAAACTGCTTTCTCTTGGCATGTTACCTGGCTCCTCTTTTAATGTGGTGCGCGTCGCTCCACTCGGCGACCCCATTCATATCGAAACCCGTCGTGTGAGCCTGGTATTACGCAAAAAAGATCTGGCCTTATTAGAAGTGGAAGCGGTTTCCTGTTAA |
| Sequence | MQYTPDTAWKITGFSREISPAYRQKLLSLGMLPGSSFNVVRVAPLGDPIHIETRRVSLVLRKKDLALLEVEAVSC |
| Source of smORF | Swiss-Prot |
| Function | Involved in Fe(2+) ion uptake (Pubmed:8407793). Does not stimulate the GTPase activity of the N-terminus of FeoB (residues 1-276). {ECO:0000269|Pubmed:23104801, ECO:0000269|Pubmed:8407793}. |
| Pubmed ID | 8407793 9278503 16738553 20005847 23104801 |
| Domain | CDD:412598 |
| Functional Category | Others |
| Uniprot ID | P0AEL3 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 114
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 198045 | 198272 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 4024458 | 4024685 | + | NZ_LR134340.1 | Escherichia marmotae |
| 3 | 3540163 | 3540390 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 3496734 | 3496961 | + | NZ_AP014857.1 | Escherichia albertii |
| 5 | 4252466 | 4252693 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 6 | 3755782 | 3756009 | - | NZ_CP038469.1 | Citrobacter tructae |
| 7 | 3509430 | 3509657 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 8 | 2442325 | 2442552 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 9 | 4668625 | 4668852 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 10 | 86642 | 86869 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 11 | 1513125 | 1513352 | + | NZ_CP053416.1 | Salmonella bongori |
| 12 | 3663901 | 3664128 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 13 | 2750391 | 2750618 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 14 | 2325458 | 2325685 | + | NZ_CP033744.1 | Citrobacter freundii |
| 15 | 1595644 | 1595871 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 16 | 4431031 | 4431258 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 17 | 211951 | 212178 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 18 | 339575 | 339802 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 19 | 1117613 | 1117840 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 20 | 372636 | 372863 | - | NZ_CP054254.1 | Klebsiella variicola |
| 21 | 390398 | 390625 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 22 | 4927897 | 4928124 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 23 | 4377649 | 4377876 | + | NC_015968.1 | Enterobacter soli |
| 24 | 355795 | 356022 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 25 | 902797 | 903024 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 26 | 3067263 | 3067490 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 27 | 4349788 | 4350015 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 28 | 4362136 | 4362363 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 29 | 2937331 | 2937558 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 30 | 4467886 | 4468113 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 31 | 4697978 | 4698205 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 32 | 5063465 | 5063692 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 33 | 362538 | 362765 | - | NZ_CP041247.1 | Raoultella electrica |
| 34 | 1315747 | 1315974 | + | NZ_CP026047.1 | Raoultella planticola |
| 35 | 400819 | 401046 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 36 | 364504 | 364731 | - | NZ_CP050508.1 | Raoultella terrigena |
| 37 | 312980 | 313207 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 38 | 2765900 | 2766127 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 39 | 4518229 | 4518456 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 40 | 4260923 | 4261150 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 41 | 3978967 | 3979194 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 42 | 2103312 | 2103539 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 43 | 4245862 | 4246089 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 44 | 2924715 | 2924942 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 45 | 363102 | 363329 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 46 | 378597 | 378824 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 47 | 161575 | 161799 | - | NZ_CP023525.1 | Cedecea neteri |
| 48 | 166220 | 166444 | - | NZ_LR134201.1 | Cedecea lapagei |
| 49 | 3725280 | 3725504 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 50 | 3959234 | 3959458 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 51 | 382886 | 383113 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 52 | 155281 | 155505 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 53 | 4042975 | 4043199 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 54 | 5766 | 5990 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 55 | 4944425 | 4944652 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 56 | 4126486 | 4126710 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 57 | 344115 | 344342 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 58 | 252394 | 252618 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 59 | 3491881 | 3492108 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 60 | 317865 | 318089 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 61 | 214227 | 214460 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 62 | 4152139 | 4152363 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 63 | 4925604 | 4925828 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 64 | 262943 | 263167 | - | NZ_CP071320.1 | Serratia ureilytica |
| 65 | 1196903 | 1197127 | + | NZ_CP065640.1 | Serratia rubidaea |
| 66 | 2097121 | 2097354 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 67 | 2444749 | 2444973 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 68 | 3916293 | 3916517 | - | NZ_CP067057.1 | Rahnella aceris |
| 69 | 163586 | 163810 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 70 | 1412408 | 1412632 | + | NZ_CP011254.1 | Serratia fonticola |
| 71 | 4889110 | 4889334 | + | NZ_LT906479.1 | Serratia ficaria |
| 72 | 786123 | 786347 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 73 | 5085784 | 5086008 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 74 | 1336022 | 1336258 | + | NZ_CP026364.1 | Proteus hauseri |
| 75 | 160770 | 161000 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 76 | 4969671 | 4969889 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 77 | 5024080 | 5024304 | + | NZ_LR134494.1 | Serratia quinivorans |
| 78 | 2043086 | 2043310 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 79 | 62011 | 62235 | - | NZ_CP046293.1 | Yersinia intermedia |
| 80 | 3717374 | 3717610 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 81 | 3203509 | 3203745 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 82 | 1310452 | 1310676 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 83 | 2932218 | 2932442 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 84 | 1486700 | 1486924 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 85 | 4443099 | 4443323 | + | NZ_CP043727.1 | Yersinia canariae |
| 86 | 261484 | 261708 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 87 | 4454668 | 4454892 | + | NZ_CP032487.1 | Yersinia hibernica |
| 88 | 2662557 | 2662781 | + | NZ_CP009787.1 | Yersinia rohdei |
| 89 | 232268 | 232495 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 90 | 1355236 | 1355463 | + | NZ_CP007230.1 | Yersinia similis |
| 91 | 4093880 | 4094107 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 92 | 144626 | 144856 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 93 | 195113 | 195343 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 94 | 2077096 | 2077320 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 95 | 1254658 | 1254891 | + | NZ_CP019706.1 | Pantoea alhagi |
| 96 | 334951 | 335184 | - | NZ_CP061511.1 | Mixta calida |
| 97 | 3465942 | 3466169 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 98 | 261077 | 261304 | - | NZ_LS483470.1 | Leminorella richardii |
| 99 | 405712 | 405951 | - | NZ_CP026377.1 | Mixta gaviniae |
| 100 | 4232894 | 4233118 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 101 | 4887279 | 4887497 | - | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 102 | 800356 | 800586 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 103 | 311903 | 312133 | - | NZ_LS483422.1 | Providencia heimbachae |
| 104 | 559251 | 559481 | + | NZ_CP029736.1 | Providencia rettgeri |
| 105 | 4069931 | 4070161 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 106 | 259469 | 259699 | - | NZ_CP048796.1 | Providencia vermicola |
| 107 | 3558101 | 3558325 | + | NZ_CP060401.1 | Xenorhabdus nematophila |
| 108 | 1764085 | 1764312 | + | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 109 | 4663542 | 4663766 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 110 | 238414 | 238641 | - | NZ_LR134531.1 | Pragia fontium |
| 111 | 4220138 | 4220365 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 112 | 3401460 | 3401687 | + | NZ_CP029185.2 | Limnobaculum parvum |
| 113 | 4161471 | 4161704 | - | NZ_CP028271.1 | Mixta intestinalis |
| 114 | 3781026 | 3781256 | + | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 115 | 3536919 | 3537158 | + | NZ_CP020470.1 | Rhodobacter blasticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061527.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02518.28 | 0.76 | 87 | 4321.5 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 2 | PF00512.27 | 0.76 | 87 | 4321.5 | opposite-strand | His Kinase A (phospho-acceptor) domain |
| 3 | PF00672.27 | 0.71 | 81 | 4302.0 | opposite-strand | HAMP domain |
| 4 | PF00072.26 | 0.82 | 93 | 3615.0 | opposite-strand | Response regulator receiver domain |
| 5 | PF00486.30 | 0.82 | 93 | 3615.0 | opposite-strand | Transcriptional regulatory protein, C terminal |
| 6 | PF03449.17 | 0.89 | 102 | 2895 | same-strand | Transcription elongation factor, N-terminal |
| 7 | PF01272.21 | 0.89 | 102 | 2895 | same-strand | Transcription elongation factor, GreA/GreB, C-term |
| 8 | PF09371.12 | 0.91 | 104 | 448 | same-strand | Tex-like protein N-terminal domain |
| 9 | PF16921.7 | 0.91 | 104 | 448 | same-strand | Tex protein YqgF-like domain |
| 10 | PF12836.9 | 0.91 | 104 | 448 | same-strand | Helix-hairpin-helix motif |
| 11 | PF00575.25 | 0.91 | 104 | 448 | same-strand | S1 RNA binding domain |
| 12 | PF17674.3 | 0.91 | 104 | 448 | same-strand | HHH domain |
| 13 | PF14635.8 | 0.91 | 104 | 448 | same-strand | Helix-hairpin-helix motif |
| 14 | PF02421.20 | 1.0 | 114 | 31 | same-strand | Ferrous iron transport protein B |
| 15 | PF07670.16 | 1.0 | 114 | 31 | same-strand | Nucleoside recognition |
| 16 | PF07664.14 | 1.0 | 114 | 31 | same-strand | Ferrous iron transport protein B C terminus |
| 17 | PF01926.25 | 0.99 | 113 | 31.0 | same-strand | 50S ribosome-binding GTPase |
| 18 | PF17910.3 | 0.9 | 103 | 31.0 | same-strand | FeoB cytosolic helical domain |
| 19 | PF09012.12 | 0.95 | 108 | 2362 | same-strand | FeoC like transcriptional regulator |
| 20 | PF00561.22 | 0.83 | 95 | 3073.5 | opposite-strand | alpha/beta hydrolase fold |
| 21 | PF12697.9 | 0.84 | 96 | 3074 | opposite-strand | Alpha/beta hydrolase family |
| 22 | PF12146.10 | 0.82 | 94 | 3073 | opposite-strand | Serine aminopeptidase, S33 |
++ More..