Result : A4VNI2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein PST_2887 |
| NCBI Accession ID | CP000304.1 |
| Organism | Pseudomonas stutzeri (strain A1501) |
| Left | 3108338 |
| Right | 3108553 |
| Strand | - |
| Nucleotide Sequence | ATGAAGCGCGTCGCCTTGCAATCGAGCAGCCTGCGCTCGCTGGGCTACGACCCCGAGCAGCAGATACTGGAGGTGGAATTCAGCAGCGGTGCGCTGTATCGCTACGAGGCGGTTCCGCCCGAGGTGGTGCAGGCGTTGCTGGAGGCCGACTCGCTGGGCCGGCATTTCAATCAGGTATTCAAGCCGCAGCACTATCGCTATTGGCGAATCGACTGA |
| Sequence | MKRVALQSSSLRSLGYDPEQQILEVEFSSGALYRYEAVPPEVVQALLEADSLGRHFNQVFKPQHYRYWRID |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam13619. Profile Description: KTSC domain. This short domain is named after Lysine tRNA synthetase C-terminal domain. It is found at the C-terminus of some Lysyl tRNA synthetases as well as a single domain in bacterial proteins. The domain is about 60 amino acids in length and contains a reasonably conserved YXY motif in the centre of the sequence. The function of this domain is unknown but it could be an RNA binding domain. |
| Pubmed ID | 18495935 |
| Domain | CDD:404502 |
| Functional Category | Others |
| Uniprot ID | A4VNI2 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3356607 | 3356792 | + | NZ_CP036276.1 | Symmachiella dynata |
| 2 | 499207 | 499422 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
++ More..