Protein name |
Uncharacterized protein PST_2887 |
NCBI Accession ID |
CP000304.1 |
Organism |
Pseudomonas stutzeri (strain A1501) |
Left |
3108338 |
Right |
3108553 |
Strand |
- |
Nucleotide Sequence |
ATGAAGCGCGTCGCCTTGCAATCGAGCAGCCTGCGCTCGCTGGGCTACGACCCCGAGCAGCAGATACTGGAGGTGGAATTCAGCAGCGGTGCGCTGTATCGCTACGAGGCGGTTCCGCCCGAGGTGGTGCAGGCGTTGCTGGAGGCCGACTCGCTGGGCCGGCATTTCAATCAGGTATTCAAGCCGCAGCACTATCGCTATTGGCGAATCGACTGA |
Sequence |
MKRVALQSSSLRSLGYDPEQQILEVEFSSGALYRYEAVPPEVVQALLEADSLGRHFNQVFKPQHYRYWRID |
Source of smORF |
Swiss-Prot |
Function |
The ORF matches to the profile of pfam13619. Profile Description: KTSC domain. This short domain is named after Lysine tRNA synthetase C-terminal domain. It is found at the C-terminus of some Lysyl tRNA synthetases as well as a single domain in bacterial proteins. The domain is about 60 amino acids in length and contains a reasonably conserved YXY motif in the centre of the sequence. The function of this domain is unknown but it could be an RNA binding domain. |
Pubmed ID |
18495935
|
Domain |
CDD:404502 |
Functional Category |
Others |
Uniprot ID |
A4VNI2
|
ORF Length (Amino Acid) |
71 |