Result : P0ADQ5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YiiE |
| NCBI Accession ID | AP009048.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 3557172 |
| Right | 3557390 |
| Strand | - |
| Nucleotide Sequence | ATGGCGATGAATACGGTTTTTCTTCATTTATCAGAAGAGGCAATTAAACGGCTGAACAAGCTTCGGGGCTGGCGTAAGGTTTCACGATCTGCAATTTTACGCGAAGCGGTAGAGCAATATCTGGAACGTCAGCAATTCCCGGTGCGTAAAGCAAAGGGAGGCAGGCAAAAGGGGGAGGTAGTTGGTGTTGATGATCAGTGTAAGGAGCATAAGGAATGA |
| Sequence | MAMNTVFLHLSEEAIKRLNKLRGWRKVSRSAILREAVEQYLERQQFPVRKAKGGRQKGEVVGVDDQCKEHKE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22901. Profile Description: Ribbon-helix-helix protein, copG family. ParD is the antitoxin of a bacterial toxin-antitoxin gene pair. The cognate toxin is ParE in, pfam05016. The family contains several related antitoxins from Cyanobacteria, Proteobacteria and Actinobacteria. Antitoxins of this class carry an N-terminal ribbon-helix-helix domain, RHH, that is highly conserved across all type II bacterial antitoxins, which dimerizes with the RHH domain of a second VapB molecule. A hinge section follows the RHH, with an additional pair of flexible alpha helices at the C-terminus. This C-terminus is the toxin-binding region of the dimer, and so is specific to the cognate toxin, whereas the RHH domain has the specific function of lying across the RNA-binding groove of the toxin dimer and inactivating the active-site - a more general function of all type II antitoxins. |
| Pubmed ID | 8346018 9278503 16738553 |
| Domain | CDD:419885 |
| Functional Category | Others |
| Uniprot ID | P0ADQ5 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4094700 | 4094918 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 4079291 | 4079509 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 4878055 | 4878273 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 4259697 | 4259900 | - | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 3013612 | 3013833 | + | NZ_CP057657.1 | Escherichia fergusonii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09500.12 | 1.0 | 4 | 853 | same-strand | Putative thioesterase (yiiD Cterm) |
| 2 | PF00583.27 | 1.0 | 4 | 853 | same-strand | Acetyltransferase (GNAT) family |
| 3 | PF13508.9 | 1.0 | 4 | 853 | same-strand | Acetyltransferase (GNAT) domain |
| 4 | PF04216.14 | 1.0 | 4 | 789 | opposite-strand | Protein involved in formate dehydrogenase formation |
| 5 | PF01292.22 | 1.0 | 4 | 1715 | opposite-strand | Prokaryotic cytochrome b561 |
| 6 | PF13247.8 | 1.0 | 4 | 2347 | opposite-strand | 4Fe-4S dicluster domain |
| 7 | PF09163.13 | 1.0 | 4 | 2347 | opposite-strand | Formate dehydrogenase N, transmembrane |
| 8 | PF12838.9 | 1.0 | 4 | 2347 | opposite-strand | 4Fe-4S dicluster domain |
| 9 | PF13187.8 | 1.0 | 4 | 2347 | opposite-strand | 4Fe-4S dicluster domain |
| 10 | PF13237.8 | 1.0 | 4 | 2347 | opposite-strand | 4Fe-4S dicluster domain |
| 11 | PF12837.9 | 1.0 | 4 | 2347 | opposite-strand | 4Fe-4S binding domain |
| 12 | PF14697.8 | 1.0 | 4 | 2347 | opposite-strand | 4Fe-4S dicluster domain |
| 13 | PF03631.17 | 0.75 | 3 | 2139.0 | same-strand | Virulence factor BrkB |
| 14 | PF02580.18 | 0.75 | 3 | 1705.0 | same-strand | D-Tyr-tRNA(Tyr) deacylase |
++ More..