Result : P0ADN9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized lipoprotein YifL |
| NCBI Accession ID | AE005674.2 |
| Organism | Shigella flexneri |
| Left | 4006227 |
| Right | 4006430 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAACGTGTTTAAGGCACTCACTGTATTACTTACTCTCTTCAGCCTGACGGGCTGCGGTCTGAAAGGTCCGCTCTATTTCCCGCCTGCAGATAAAAACGCACCGCCGCCGACCAAACCGGTAGAGACGCAAACGCAATCCACGGTGCCGGATAAAAACGATCGCGCCACTGGCGATGGTCCATCCCAGGTGAATTACTAA |
| Sequence | MKNVFKALTVLLTLFSLTGCGLKGPLYFPPADKNAPPPTKPVETQTQSTVPDKNDRATGDGPSQVNY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl26118. Profile Description: Prokaryotic lipoprotein-attachment site. In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognizes a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached. |
| Pubmed ID | 12384590 12704152 |
| Domain | CDD:421266 |
| Functional Category | Others |
| Uniprot ID | P0ADN9 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 61
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2777321 | 2777524 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 2 | 4006227 | 4006430 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 3994522 | 3994725 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 4788307 | 4788510 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 4325445 | 4325648 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 6 | 4348684 | 4348887 | - | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 3965469 | 3965672 | + | NZ_AP014857.1 | Escherichia albertii |
| 8 | 3333480 | 3333683 | - | NZ_CP038469.1 | Citrobacter tructae |
| 9 | 1108770 | 1108973 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 10 | 4152035 | 4152238 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 11 | 564924 | 565127 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 12 | 144603 | 144806 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 13 | 1956758 | 1956961 | + | NZ_CP053416.1 | Salmonella bongori |
| 14 | 4164235 | 4164438 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 15 | 2323104 | 2323307 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 16 | 2766894 | 2767097 | + | NZ_CP033744.1 | Citrobacter freundii |
| 17 | 4367852 | 4368055 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 18 | 3270094 | 3270297 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 19 | 2266164 | 2266367 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 20 | 50361 | 50564 | + | NZ_CP017280.1 | Enterobacter ludwigii |
| 21 | 212151 | 212354 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 22 | 245054 | 245257 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 23 | 5398291 | 5398494 | - | NZ_CP050508.1 | Raoultella terrigena |
| 24 | 1935461 | 1935664 | + | NZ_CP026047.1 | Raoultella planticola |
| 25 | 5077840 | 5078043 | - | NZ_CP041247.1 | Raoultella electrica |
| 26 | 5946323 | 5946526 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 27 | 4520081 | 4520284 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 28 | 4639351 | 4639554 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 29 | 4519675 | 4519878 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 30 | 5039633 | 5039836 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 31 | 5329122 | 5329325 | - | NZ_CP054254.1 | Klebsiella variicola |
| 32 | 3796310 | 3796513 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 33 | 172489 | 172692 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 34 | 4873725 | 4873928 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 35 | 5376306 | 5376509 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 36 | 3331634 | 3331837 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 37 | 5521077 | 5521280 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 38 | 2796238 | 2796441 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 39 | 5205679 | 5205882 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 40 | 4420484 | 4420687 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 41 | 178294 | 178497 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 42 | 2958124 | 2958327 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 43 | 5087710 | 5087913 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 44 | 4482502 | 4482705 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 45 | 164753 | 164956 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 46 | 3147408 | 3147611 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 47 | 3867935 | 3868138 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 48 | 283890 | 284093 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 49 | 689731 | 689934 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 50 | 298859 | 299062 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 51 | 292920 | 293123 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 52 | 3745025 | 3745228 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 53 | 5921946 | 5922149 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 54 | 4379049 | 4379252 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 55 | 1450576 | 1450797 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 56 | 4575729 | 4575932 | - | NC_015968.1 | Enterobacter soli |
| 57 | 3911128 | 3911334 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 58 | 1491636 | 1491839 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 59 | 4435317 | 4435523 | - | NZ_LR134201.1 | Cedecea lapagei |
| 60 | 4479545 | 4479748 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 61 | 4322756 | 4322962 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 62 | 4859446 | 4859652 | - | NZ_CP023525.1 | Cedecea neteri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13361.8 | 1.0 | 61 | 3258.0 | same-strand | UvrD-like helicase C-terminal domain |
| 2 | PF00580.23 | 1.0 | 61 | 3258.0 | same-strand | UvrD/REP helicase N-terminal domain |
| 3 | PF13245.8 | 1.0 | 61 | 3258.0 | same-strand | AAA domain |
| 4 | PF13538.8 | 1.0 | 61 | 3258.0 | same-strand | UvrD-like helicase C-terminal domain |
| 5 | PF13419.8 | 1.0 | 61 | 2463.0 | same-strand | Haloacid dehalogenase-like hydrolase |
| 6 | PF00702.28 | 1.0 | 61 | 2463.0 | same-strand | haloacid dehalogenase-like hydrolase |
| 7 | PF00589.24 | 1.0 | 61 | 1561.0 | same-strand | Phage integrase family |
| 8 | PF02899.19 | 1.0 | 61 | 1561.0 | same-strand | Phage integrase, N-terminal SAM-like domain |
| 9 | PF04340.14 | 1.0 | 61 | 858.0 | same-strand | Protein of unknown function, DUF484 |
| 10 | PF01678.21 | 1.0 | 61 | 37.0 | same-strand | Diaminopimelate epimerase |
| 11 | PF01491.18 | 1.0 | 61 | 139.0 | opposite-strand | Frataxin-like domain |
| 12 | PF01295.20 | 0.93 | 57 | 538.0 | same-strand | Adenylate cyclase, class-I |
| 13 | PF12633.9 | 0.93 | 57 | 538.0 | same-strand | Adenylate cyclase NT domain |
| 14 | PF01379.22 | 0.93 | 57 | 3423.0 | opposite-strand | Porphobilinogen deaminase, dipyromethane cofactor binding domain |
| 15 | PF03900.17 | 0.93 | 57 | 3423.0 | opposite-strand | Porphobilinogen deaminase, C-terminal domain |
| 16 | PF04375.16 | 0.84 | 51 | 5133.0 | opposite-strand | HemX, putative uroporphyrinogen-III C-methyltransferase |
| 17 | PF02602.17 | 0.92 | 56 | 4377 | opposite-strand | Uroporphyrinogen-III synthase HemD |
++ More..