Result : P0ADJ5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cellulose biosynthesis protein BcsF |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 3698026 |
| Right | 3698217 |
| Strand | + |
| Nucleotide Sequence | ATGATGACCATCAGCGATATCATTGAAATTATTGTCGTTTGCGCACTGATATTTTTCCCGCTGGGCTATCTGGCGCGGCACTCTTTGCGACGCATTCGCGACACCTTACGTTTGTTCTTTGCTAAACCTCGTTATGTTAAACCGGCCGGGACGTTACGCCGCACGGAAAAAGCCAGGGCAACCAAAAAATGA |
| Sequence | MMTISDIIEIIVVCALIFFPLGYLARHSLRRIRDTLRLFFAKPRYVKPAGTLRRTEKARATKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl24004. Profile Description: Cellulose biosynthesis protein BcsF. Members of this protein family are found invariably together with genes of bacterial cellulose biosynthesis, and are presumed to be involved in the process. Members average about 63 amino acids in length and are not uncharacterized. The gene has been designated both YhjT and BcsF (bacterial cellulose synthesis F). [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides] |
| Pubmed ID | 8041620 9278503 16738553 24097954 |
| Domain | CDD:420147 |
| Functional Category | Others |
| Uniprot ID | P0ADJ5 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 54
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3698026 | 3698217 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 4440297 | 4440488 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 3667639 | 3667830 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 3709117 | 3709308 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 2610230 | 2610421 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 1433991 | 1434182 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 7 | 240103 | 240294 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 8 | 4507804 | 4507995 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 9 | 1650124 | 1650315 | + | NZ_CP053416.1 | Salmonella bongori |
| 10 | 3806244 | 3806435 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 11 | 4574959 | 4575150 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 12 | 4193629 | 4193820 | + | NZ_LR134340.1 | Escherichia marmotae |
| 13 | 3205599 | 3205766 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 14 | 3660835 | 3661026 | + | NZ_AP014857.1 | Escherichia albertii |
| 15 | 2218610 | 2218777 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 16 | 3854414 | 3854608 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 17 | 2846904 | 2847098 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 18 | 4591597 | 4591791 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 19 | 3069502 | 3069696 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 20 | 4372924 | 4373118 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 21 | 4469397 | 4469591 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 22 | 4822329 | 4822523 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 23 | 4471360 | 4471554 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 24 | 4511846 | 4512040 | + | NC_015968.1 | Enterobacter soli |
| 25 | 1473702 | 1473899 | + | NZ_CP026047.1 | Raoultella planticola |
| 26 | 255598 | 255795 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 27 | 298014 | 298211 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 28 | 224699 | 224896 | - | NZ_CP050508.1 | Raoultella terrigena |
| 29 | 300400 | 300597 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 30 | 231206 | 231403 | - | NZ_CP041247.1 | Raoultella electrica |
| 31 | 206960 | 207160 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 32 | 212049 | 212246 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 33 | 174148 | 174345 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 34 | 2916926 | 2917123 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 35 | 4661992 | 4662189 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 36 | 249095 | 249292 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 37 | 4897128 | 4897325 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 38 | 713863 | 714060 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 39 | 242667 | 242864 | - | NZ_CP054254.1 | Klebsiella variicola |
| 40 | 228283 | 228480 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 41 | 4390253 | 4390450 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 42 | 3343529 | 3343726 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 43 | 209930 | 210127 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 44 | 5116568 | 5116765 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 45 | 5057195 | 5057392 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 46 | 929350 | 929547 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 47 | 5142411 | 5142605 | - | NZ_CP023525.1 | Cedecea neteri |
| 48 | 4742419 | 4742580 | - | NZ_LR134201.1 | Cedecea lapagei |
| 49 | 611996 | 612178 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 50 | 3607336 | 3607533 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 51 | 4253540 | 4253737 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 52 | 37707 | 37904 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 53 | 4158584 | 4158781 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 54 | 4259032 | 4259229 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 55 | 4077603 | 4077800 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT556085.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03170.15 | 0.93 | 50 | 5347.5 | opposite-strand | Bacterial cellulose synthase subunit |
| 2 | PF00535.28 | 0.96 | 52 | 2683 | opposite-strand | Glycosyl transferase family 2 |
| 3 | PF13632.8 | 0.96 | 52 | 2683 | opposite-strand | Glycosyl transferase family group 2 |
| 4 | PF13641.8 | 0.96 | 52 | 2683 | opposite-strand | Glycosyltransferase like family 2 |
| 5 | PF07238.16 | 0.96 | 52 | 2683 | opposite-strand | PilZ domain |
| 6 | PF13506.8 | 0.96 | 52 | 2683 | opposite-strand | Glycosyl transferase family 21 |
| 7 | PF06564.14 | 0.98 | 53 | 1934 | opposite-strand | Cellulose biosynthesis protein BcsQ |
| 8 | PF01656.25 | 0.61 | 33 | 1934 | opposite-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 9 | PF10945.10 | 0.91 | 49 | 1733.0 | opposite-strand | Cellulose biosynthesis protein BcsR |
| 10 | PF10995.10 | 0.96 | 52 | -3 | same-strand | Cellulose biosynthesis GIL |
| 11 | PF11658.10 | 0.98 | 53 | -7.0 | same-strand | Cellulose biosynthesis protein BcsG |
| 12 | PF13614.8 | 0.89 | 48 | 1932.5 | opposite-strand | AAA domain |
++ More..