Result : P0ADJ4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein YhjR |
| NCBI Accession ID | AE014073.1 |
| Organism | Shigella flexneri |
| Left | 4108285 |
| Right | 4108473 |
| Strand | + |
| Nucleotide Sequence | ATGAATAACAATGAACCAGATACTCTGCCTGATCCCGCGATAGGCTATATCTTCCAGAATGATATTGTGGCGTTAAAGCAGGCATTTTCACTGCCTGATATTGATTATGCCGATATTTCCCAACGCGAACAGTTGGCCGCGGCATTAAAACGCTGGCCGTTGCTGGCAGAGTTTGCGCAACAAAAGTAG |
| Sequence | MNNNEPDTLPDPAIGYIFQNDIVALKQAFSLPDIDYADISQREQLAAALKRWPLLAEFAQQK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10945. Profile Description: Cellulose biosynthesis protein BcsR. CBP_BcsR is a family of bacterial cellulose biosynthesis proteins. Cellulose is necessary for biofilm formation in bacteria. Roemling U. and Galperin M.Y. "Bacterial cellulose biosynthesis. Diversity of operons and subunits" (manuscript in preparation). |
| Pubmed ID | 12384590 12704152 |
| Domain | CDD:402499 |
| Functional Category | Others |
| Uniprot ID | P0ADJ4 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 55
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3695997 | 3696185 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 3713952 | 3714140 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 4438268 | 4438456 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 4191614 | 4191802 | - | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 3658805 | 3658993 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 2608199 | 2608387 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 4509838 | 4510026 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 8 | 4572918 | 4573070 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 9 | 4509926 | 4510114 | - | NC_015968.1 | Enterobacter soli |
| 10 | 3856337 | 3856525 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 11 | 4660075 | 4660263 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 12 | 2915008 | 2915196 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 13 | 3067581 | 3067769 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 14 | 5114649 | 5114837 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 15 | 2216662 | 2216850 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 16 | 4589676 | 4589864 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 17 | 4467478 | 4467666 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 18 | 4469438 | 4469626 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 19 | 2848833 | 2849021 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 20 | 4820410 | 4820598 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 21 | 1436027 | 1436215 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 22 | 238070 | 238258 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 23 | 3804228 | 3804431 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 24 | 1648123 | 1648311 | - | NZ_CP053416.1 | Salmonella bongori |
| 25 | 211858 | 212046 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 26 | 4899053 | 4899241 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 27 | 4371002 | 4371190 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 28 | 3203649 | 3203837 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 29 | 4388284 | 4388481 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 30 | 715788 | 715976 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 31 | 208889 | 209077 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 32 | 257652 | 257852 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 33 | 3345457 | 3345645 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 34 | 176119 | 176307 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 35 | 1471791 | 1471979 | - | NZ_CP026047.1 | Raoultella planticola |
| 36 | 251016 | 251204 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 37 | 233122 | 233310 | + | NZ_CP041247.1 | Raoultella electrica |
| 38 | 226618 | 226806 | + | NZ_CP050508.1 | Raoultella terrigena |
| 39 | 302318 | 302506 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 40 | 230203 | 230391 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 41 | 5055285 | 5055473 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 42 | 244586 | 244774 | + | NZ_CP054254.1 | Klebsiella variicola |
| 43 | 299932 | 300120 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 44 | 213968 | 214156 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 45 | 5144337 | 5144522 | + | NZ_CP023525.1 | Cedecea neteri |
| 46 | 4744345 | 4744530 | + | NZ_LR134201.1 | Cedecea lapagei |
| 47 | 159011 | 159205 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 48 | 3609273 | 3609476 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 49 | 39648 | 39851 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 50 | 4075656 | 4075859 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 51 | 4257091 | 4257297 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 52 | 4255481 | 4255687 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 53 | 4156640 | 4156846 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 54 | 610046 | 610234 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 55 | 4591654 | 4591845 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 56 | 104648 | 104839 | + | NZ_CP038662.1 | Serratia nematodiphila |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134340.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05420.13 | 0.96 | 53 | 6860 | same-strand | Cellulose synthase operon protein C C-terminus (BCSC C) |
| 2 | PF14559.8 | 0.82 | 45 | 6869 | same-strand | Tetratricopeptide repeat |
| 3 | PF13432.8 | 0.95 | 52 | 6858.5 | same-strand | Tetratricopeptide repeat |
| 4 | PF01270.19 | 0.98 | 54 | 5736 | same-strand | Glycosyl hydrolases family 8 |
| 5 | PF03170.15 | 1.0 | 55 | 3423.0 | same-strand | Bacterial cellulose synthase subunit |
| 6 | PF00535.28 | 0.98 | 54 | 761 | same-strand | Glycosyl transferase family 2 |
| 7 | PF13632.8 | 1.0 | 55 | 761.0 | same-strand | Glycosyl transferase family group 2 |
| 8 | PF13641.8 | 0.98 | 54 | 761 | same-strand | Glycosyltransferase like family 2 |
| 9 | PF07238.16 | 1.0 | 55 | 761.0 | same-strand | PilZ domain |
| 10 | PF13506.8 | 0.98 | 54 | 761 | same-strand | Glycosyl transferase family 21 |
| 11 | PF06564.14 | 0.98 | 54 | 12.0 | same-strand | Cellulose biosynthesis protein BcsQ |
| 12 | PF01656.25 | 0.62 | 34 | 12.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 13 | PF10995.10 | 0.96 | 53 | 175.0 | opposite-strand | Cellulose biosynthesis GIL |
| 14 | PF11120.10 | 0.95 | 52 | 1734 | opposite-strand | Cellulose biosynthesis protein BcsF |
| 15 | PF11658.10 | 0.98 | 54 | 1921 | opposite-strand | Cellulose biosynthesis protein BcsG |
| 16 | PF13614.8 | 0.85 | 47 | 12 | same-strand | AAA domain |
++ More..