ProsmORF-pred
Result : P0ADG3
Protein Information
Information Type Description
Protein name Acetolactate synthase isozyme 2 small subunit (EC 2.2.1.6) (ALS-II) (Acetohydroxy-acid synthase II small subunit) (AHAS-II)
NCBI Accession ID
Organism Shigella flexneri
Left
Right
Strand
Nucleotide Sequence
Sequence MMQHQVNVSARFNPETLERVLRVVRHRGFHVCSMNMAAASDAQNINIELTVASPRSVDLLFSQLNKLVDVAHVAICQSTTTSQQIRA
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl09141. Profile Description: ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme. The ACT domain is a structural motif of 70-90 amino acids that functions in the control of metabolism, solute transport and signal transduction. They are thus found in a variety of different proteins in a variety of different arrangements. In mammalian phenylalanine hydroxylase the domain forms no contacts but promotes an allosteric effect despite the apparent lack of ligand binding.
Pubmed ID 12384590 12704152
Domain CDD:415594
Functional Category Others
Uniprot ID P0ADG3
ORF Length (Amino Acid) 87
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 157
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 4281198 4281461 + NZ_CP061527.1 Shigella dysenteriae
2 4391844 4392107 - NZ_LR134340.1 Escherichia marmotae
3 2821777 2822040 - NZ_CP057657.1 Escherichia fergusonii
4 3961643 3961906 + NC_004337.2 Shigella flexneri 2a str. 301
5 3952201 3952464 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
6 4745773 4746036 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
7 3919323 3919586 + NZ_AP014857.1 Escherichia albertii
8 104189 104452 + NC_009792.1 Citrobacter koseri ATCC BAA-895
9 3369151 3369414 - NZ_CP038469.1 Citrobacter tructae
10 2362534 2362797 - NZ_CP044098.1 Citrobacter portucalensis
11 2727484 2727747 + NZ_CP033744.1 Citrobacter freundii
12 4110629 4110892 + NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
13 4206166 4206429 - NC_013716.1 Citrobacter rodentium ICC168
14 1158381 1158644 - NZ_LT556085.1 Citrobacter amalonaticus
15 1916122 1916385 + NZ_CP053416.1 Salmonella bongori
16 2758983 2759246 + NZ_CP025034.2 Enterobacter sp. SGAir0187
17 3760328 3760591 + NZ_CP045769.1 Enterobacter cancerogenus
18 13240 13503 + NZ_CP017280.1 Enterobacter ludwigii
19 2624463 2624726 + NZ_AP019007.1 Enterobacter oligotrophicus
20 3307766 3308029 - NZ_CP023529.1 Lelliottia amnigena
21 514137 514400 + NZ_CP045205.1 Citrobacter telavivensis
22 4457576 4457839 - NZ_AP022508.1 Enterobacter bugandensis
23 4556887 4557150 - NZ_CP027986.1 Enterobacter sichuanensis
24 4557269 4557532 - NZ_CP017184.1 Enterobacter roggenkampii
25 4676509 4676772 - NZ_CP009756.1 Enterobacter cloacae
26 4910914 4911177 - NZ_CP043318.1 Enterobacter chengduensis
27 4614964 4615227 - NC_015968.1 Enterobacter soli
28 286691 286954 - NZ_CP051548.1 Phytobacter diazotrophicus
29 4407495 4407758 - NZ_CP011602.1 Phytobacter ursingii
30 727061 727324 - NZ_CP020388.1 Pluralibacter gergoviae
31 4418576 4418839 - NZ_CP054058.1 Scandinavium goeteborgense
32 2994963 2995232 - NZ_CP045300.1 Kosakonia arachidis
33 5241711 5241980 - NZ_CP014007.2 Kosakonia oryzae
34 5484973 5485242 + NZ_CP015113.1 Kosakonia radicincitans
35 3294333 3294602 + NZ_CP016337.1 Kosakonia sacchari
36 141191 141460 + NZ_CP063425.1 Kosakonia pseudosacchari
37 131137 131394 + NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
38 118881 119150 + NZ_CP012871.1 [Enterobacter] lignolyticus
39 4522965 4523231 - NZ_CP045845.1 Kluyvera intermedia
40 5078141 5078398 - NZ_CP065838.1 Klebsiella quasipneumoniae
41 174265 174534 + NZ_CP013990.1 Leclercia adecarboxylata
42 5370419 5370676 - NZ_CP054254.1 Klebsiella variicola
43 5128953 5129210 - NZ_LR134475.1 Klebsiella aerogenes
44 4524477 4524743 - NZ_CP035129.1 Kosakonia cowanii
45 3189751 3190008 - NZ_CP027107.1 Cronobacter sakazakii
46 3789450 3789707 - NZ_CP012268.1 Cronobacter muytjensii ATCC 51329
47 254704 254961 + NZ_CP012266.1 Cronobacter dublinensis subsp. dublinensis LMG 23823
48 1896907 1897164 + NZ_CP026047.1 Raoultella planticola
49 5412984 5413241 - NZ_CP046672.1 Raoultella ornithinolytica
50 1530491 1530760 - NZ_CP042941.1 Atlantibacter hermannii
51 5114547 5114804 - NZ_CP041247.1 Raoultella electrica
52 1414489 1414746 + NZ_CP040428.1 Jejubacter calystegiae
53 5998606 5998863 - NZ_CP060111.1 Klebsiella michiganensis
54 260648 260911 + NZ_CP012264.1 Cronobacter condimenti 1330
55 5977307 5977564 - NZ_CP036175.1 Klebsiella huaxiensis
56 4896527 4896784 - NZ_CP023525.1 Cedecea neteri
57 5435425 5435682 - NZ_CP050508.1 Raoultella terrigena
58 4472607 4472864 - NZ_LR134201.1 Cedecea lapagei
59 1305130 1305396 - NZ_CP065640.1 Serratia rubidaea
60 1152065 1152322 + NZ_CP007044.2 Chania multitudinisentens RB-25
61 5162392 5162649 - NZ_LR134494.1 Serratia quinivorans
62 2722751 2723008 + NZ_CP014136.1 Gibbsiella quercinecans
63 5070597 5070854 - NZ_CP038662.1 Serratia nematodiphila
64 189835 190092 + NZ_CP012257.1 Cronobacter universalis NCTC 9529
65 122322 122579 + NZ_CP071320.1 Serratia ureilytica
66 5246230 5246487 - NC_015567.1 Serratia plymuthica AS9
67 4282796 4283053 - NZ_CP016948.1 Serratia surfactantfaciens
68 3949019 3949282 - NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
69 5018234 5018491 - NZ_LT906479.1 Serratia ficaria
70 2088979 2089236 - NZ_CP011078.1 Yersinia ruckeri
71 3457874 3458137 - NZ_CP067057.1 Rahnella aceris
72 3057692 3057949 + NZ_CP009787.1 Yersinia rohdei
73 165394 165651 + NZ_CP043727.1 Yersinia canariae
74 168619 168876 + NZ_CP032487.1 Yersinia hibernica
75 1792962 1793219 + NZ_CP007230.1 Yersinia similis
76 4514377 4514634 - NZ_CP011118.1 Yersinia enterocolitica
77 4406429 4406686 - NZ_LR134373.1 Yersinia pseudotuberculosis
78 3500320 3500577 - NZ_CP028271.1 Mixta intestinalis
79 3912530 3912787 - NZ_CP013940.1 Cronobacter malonaticus LMG 23826
80 1036013 1036270 - NZ_CP054043.1 Yersinia mollaretii ATCC 43969
81 4357128 4357385 - NZ_AP023184.1 Buttiauxella agrestis
82 3849711 3849968 - NZ_CP034148.1 Pantoea agglomerans
83 218112 218369 + NZ_CP045720.1 Pantoea eucalypti
84 231708 231965 + NZ_CP038853.1 Pantoea vagans
85 4516418 4516630 - NZ_CP046293.1 Yersinia intermedia
86 2512591 2512803 - NZ_CP009781.1 Yersinia aldovae 670-83
87 2684536 2684793 - NZ_CP049115.1 Pantoea stewartii
88 244508 244768 + NZ_CP051652.1 Pectobacterium carotovorum
89 256707 256967 + NZ_CP065044.1 Pectobacterium aroidearum
90 312830 313087 + NZ_CP006569.1 Sodalis praecaptivus
91 208088 208345 + NC_014306.1 Erwinia billingiae Eb661
92 216090 216350 + NZ_CP038498.1 Pectobacterium punjabense
93 3446402 3446662 - NZ_CP017482.1 Pectobacterium polaris
94 1540459 1540716 - NZ_CP011254.1 Serratia fonticola
95 234195 234452 + NC_017554.1 Pantoea ananatis PA13
96 1904734 1904994 + NZ_CP047495.1 Pectobacterium brasiliense
97 4482715 4482975 + NZ_CP015749.1 Pectobacterium parmentieri
98 1388891 1389151 - NZ_CP015750.1 Pectobacterium wasabiae CFBP 3304
99 4632735 4632995 - NZ_CP034938.1 Pectobacterium odoriferum
100 4837810 4838067 - NC_012962.1 Photorhabdus asymbiotica
101 4636481 4636741 - NZ_CP009125.1 Pectobacterium atrosepticum
102 5106493 5106750 - NZ_CP048784.1 Serratia liquefaciens
103 5463013 5463270 - NC_005126.1 Photorhabdus laumondii subsp. laumondii TTO1
104 189019 189276 + NC_013961.1 Erwinia amylovora CFBP1430
105 4032734 4032991 - NC_013892.1 Xenorhabdus bovienii SS-2004
106 3799377 3799634 - NZ_CP023567.1 Erwinia pyrifoliae
107 1792239 1792481 + NZ_CP019706.1 Pantoea alhagi
108 222062 222319 + NC_010694.1 Erwinia tasmaniensis Et1/99
109 1650619 1650876 - NZ_CP011104.1 Photorhabdus thracensis
110 3135966 3136223 - NZ_CP060401.1 Xenorhabdus nematophila
111 152254 152511 + NZ_LN907827.1 Erwinia gerundensis
112 3131600 3131857 - NZ_CP016176.1 Xenorhabdus hominickii
113 4595990 4596247 - NC_014500.1 Dickeya dadantii 3937
114 1853568 1853825 - NZ_CP015137.1 Dickeya solani IPO 2222
115 3645163 3645423 - NZ_CP034035.1 Brenneria rubrifaciens
116 4380476 4380733 - NC_012880.1 Musicola paradisiaca Ech703
117 4157814 4158071 - NZ_CP072455.1 Xenorhabdus budapestensis
118 179017 179259 + NZ_CP065534.1 Lonsdalea populi
119 4403965 4404222 - NZ_CP025799.1 Dickeya zeae
120 4269217 4269474 - NZ_LT615367.1 Dickeya aquatica
121 295166 295423 + NZ_CP042220.2 Dickeya poaceiphila
122 4197742 4198005 - NZ_CP015581.1 Tatumella citrea
123 145065 145322 + NZ_CP050150.1 Hafnia alvei
124 3113452 3113709 + NZ_CP009460.1 Dickeya fangzhongdai
125 3713518 3713775 - NZ_CP029185.2 Limnobaculum parvum
126 3455712 3455969 - NZ_FO704551.1 Xenorhabdus poinarii G6
127 167307 167564 + NC_012912.1 Dickeya chrysanthemi Ech1591
128 907549 907791 - NZ_CP023009.1 Lonsdalea britannica
129 4368332 4368589 - NZ_CP026377.1 Mixta gaviniae
130 266863 267126 + NZ_CP034036.1 Brenneria nigrifluens DSM 30175 = ATCC 13028
131 4557334 4557597 + NZ_CP014137.1 Brenneria goodwinii
132 305213 305470 + NZ_FO704550.1 Xenorhabdus doucetiae
133 3918336 3918593 - NZ_LR134531.1 Pragia fontium
134 4618817 4619074 - NZ_CP031560.1 Dickeya dianthicola
135 273552 273809 + NZ_CP034752.1 Jinshanibacter zhutongyuii
136 3848738 3848995 - NZ_LS483470.1 Leminorella richardii
137 1738711 1738992 + NZ_CP026364.1 Proteus hauseri
138 1004849 1005118 + NZ_CP029736.1 Providencia rettgeri
139 4063462 4063719 - NZ_CP061511.1 Mixta calida
140 3533908 3534177 - NZ_CP031123.2 Providencia huaxiensis
141 169325 169600 + NZ_CP047349.1 Proteus terrae subsp. cibarius
142 1224090 1224359 + NZ_CP023536.1 Providencia alcalifaciens
143 4065902 4066171 - NZ_CP048796.1 Providencia vermicola
144 4071937 4072206 - NZ_LS483422.1 Providencia heimbachae
145 72276 72563 + NC_012779.2 Edwardsiella ictaluri 93-146
146 4052528 4052788 - NZ_CP012621.1 Zobellella denitrificans
147 3386444 3386710 + NC_012691.1 Tolumonas auensis DSM 9187
148 2809758 2810015 + NZ_CP040021.1 Salinivibrio kushneri
149 3382338 3382550 - NZ_CP051883.1 Aeromonas salmonicida
150 1603742 1603960 - NZ_CP023706.1 Edwardsiella tarda
151 3673920 3674138 - NZ_CP016043.1 Edwardsiella hoshinae
152 113063 113311 + NZ_LR134376.1 Aeromonas encheleia
153 156713 156991 + NZ_AP022188.1 Aeromonas media
154 3436295 3436573 + NZ_CP044060.1 Aeromonas veronii
155 1837585 1837872 + NZ_CP006664.1 Edwardsiella anguillarum ET080813
156 3681225 3681503 + NZ_CP065745.1 Aeromonas allosaccharophila
157 158817 159035 + NC_011852.1 Glaesserella parasuis SH0165
158 845392 845622 + NZ_CP028926.1 Pasteurella multocida
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_LR134340.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF13335.8 0.97 153 2234.0 opposite-strand Magnesium chelatase, subunit ChlI C-terminal
2 PF01078.23 0.97 152 2234 opposite-strand Magnesium chelatase, subunit ChlI
3 PF07728.16 0.97 153 2234.0 opposite-strand AAA domain (dynein-related subfamily)
4 PF02776.20 1.0 157 -3.0 same-strand Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
5 PF02775.23 1.0 157 -3.0 same-strand Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
6 PF00205.24 1.0 157 -3.0 same-strand Thiamine pyrophosphate enzyme, central domain
7 PF01063.21 0.99 155 20.0 same-strand Amino-transferase class IV
8 PF00920.23 0.99 156 1024 same-strand Dehydratase family
9 PF00291.27 0.99 156 2879 same-strand Pyridoxal-phosphate dependent enzyme
10 PF00585.20 0.99 156 2879 same-strand C-terminal regulatory domain of Threonine dehydratase
11 PF03466.22 0.94 147 4409.5 opposite-strand LysR substrate binding domain
12 PF00126.29 0.94 147 4409.5 opposite-strand Bacterial regulatory helix-turn-helix protein, lysR family
13 PF13541.8 0.96 151 2234.0 opposite-strand Subunit ChlI of Mg-chelatase
14 PF04219.14 0.89 140 3808 same-strand Protein of unknown function, DUF
++ More..