Result : P0ADD9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YjjY |
| NCBI Accession ID | U14003.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 331235 |
| Right | 331375 |
| Strand | + |
| Nucleotide Sequence | ATGACTAAAGTACGTAATTGCGTTCTTGATGCACTTTCCATCAACGTCAACAACATCATTAGCTTGGTCGTGGGTACTTTCCCTCAGGACCCGACAGTGTCAAAAACGGCTGTCATCCTAACCATTTTAACAGCAACATAA |
| Sequence | MTKVRNCVLDALSINVNNIISLVVGTFPQDPTVSKTAVILTILTAT |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7610040 9278503 16738553 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P0ADD9 |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 62
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5497328 | 5497468 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 4655917 | 4656057 | + | NZ_AP014857.1 | Escherichia albertii |
| 3 | 4640402 | 4640542 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 4605952 | 4606092 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 625804 | 625944 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 3615781 | 3615921 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 7 | 5220275 | 5220415 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 8 | 4747060 | 4747200 | - | NZ_CP054254.1 | Klebsiella variicola |
| 9 | 1800693 | 1800833 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 10 | 5345400 | 5345540 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 11 | 4197543 | 4197683 | - | NZ_CP023525.1 | Cedecea neteri |
| 12 | 4439970 | 4440110 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 13 | 4856200 | 4856340 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 14 | 3919942 | 3920082 | - | NZ_LR134201.1 | Cedecea lapagei |
| 15 | 3158424 | 3158564 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 16 | 721636 | 721776 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 17 | 3531511 | 3531651 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 18 | 3931584 | 3931724 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 19 | 2605856 | 2605996 | + | NZ_CP053416.1 | Salmonella bongori |
| 20 | 4907162 | 4907302 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 21 | 2214734 | 2214874 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 22 | 3438397 | 3438537 | + | NZ_CP033744.1 | Citrobacter freundii |
| 23 | 1617182 | 1617322 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 24 | 1065075 | 1065215 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 25 | 4844644 | 4844784 | - | NZ_CP050508.1 | Raoultella terrigena |
| 26 | 4734883 | 4735023 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 27 | 2496390 | 2496530 | + | NZ_CP026047.1 | Raoultella planticola |
| 28 | 4505549 | 4505689 | - | NZ_CP041247.1 | Raoultella electrica |
| 29 | 503059 | 503199 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 30 | 3865898 | 3866038 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 31 | 5145289 | 5145429 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 32 | 4585013 | 4585153 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 33 | 724949 | 725089 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 34 | 2348719 | 2348859 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 35 | 3963097 | 3963237 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 36 | 2872209 | 2872349 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 37 | 3814608 | 3814748 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 38 | 699342 | 699482 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 39 | 2679270 | 2679410 | - | NZ_CP038469.1 | Citrobacter tructae |
| 40 | 648234 | 648374 | + | NC_015968.1 | Enterobacter soli |
| 41 | 4119853 | 4119993 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 42 | 3201598 | 3201738 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 43 | 747884 | 748024 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 44 | 4474358 | 4474498 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 45 | 4095806 | 4095946 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 46 | 798814 | 798954 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 47 | 1851116 | 1851256 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 48 | 673533 | 673673 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 49 | 654013 | 654153 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 50 | 681618 | 681758 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 51 | 2364116 | 2364256 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 52 | 5116999 | 5117139 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 53 | 645498 | 645629 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 54 | 3954390 | 3954530 | - | NZ_CP046293.1 | Yersinia intermedia |
| 55 | 3872518 | 3872658 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 56 | 2344221 | 2344361 | + | NZ_CP007230.1 | Yersinia similis |
| 57 | 746574 | 746714 | + | NZ_CP043727.1 | Yersinia canariae |
| 58 | 3974552 | 3974692 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 59 | 2840792 | 2840932 | + | NZ_CP011078.1 | Yersinia ruckeri |
| 60 | 1958387 | 1958527 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 61 | 3396811 | 3396951 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 62 | 3601496 | 3601636 | + | NZ_CP009787.1 | Yersinia rohdei |
| 63 | 5294710 | 5294841 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134340.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05981.14 | 0.89 | 55 | 4396.5 | same-strand | CreA protein |
| 2 | PF00072.26 | 1.0 | 62 | 96 | opposite-strand | Response regulator receiver domain |
| 3 | PF00486.30 | 1.0 | 62 | 96 | opposite-strand | Transcriptional regulatory protein, C terminal |
| 4 | PF00588.21 | 0.85 | 53 | 400.0 | same-strand | SpoU rRNA Methylase family |
| 5 | PF00742.21 | 0.92 | 57 | 1446 | same-strand | Homoserine dehydrogenase |
| 6 | PF00696.30 | 0.92 | 57 | 1446 | same-strand | Amino acid kinase family |
| 7 | PF03447.18 | 0.92 | 57 | 1446 | same-strand | Homoserine dehydrogenase, NAD binding domain |
| 8 | PF13840.8 | 0.92 | 57 | 1446 | same-strand | ACT domain |
| 9 | PF01842.27 | 0.85 | 53 | 1446 | same-strand | ACT domain |
| 10 | PF00288.28 | 0.92 | 57 | 3910 | same-strand | GHMP kinases N terminal domain |
| 11 | PF08544.15 | 0.92 | 57 | 3910 | same-strand | GHMP kinases C terminal |
| 12 | PF00291.27 | 0.92 | 57 | 4843 | same-strand | Pyridoxal-phosphate dependent enzyme |
| 13 | PF14821.8 | 0.92 | 57 | 4843 | same-strand | Threonine synthase N terminus |
++ More..