Result : P0ADC0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Entericidin B |
| NCBI Accession ID | AE005674.2 |
| Organism | Shigella flexneri |
| Left | 4480939 |
| Right | 4481085 |
| Strand | + |
| Nucleotide Sequence | ATGGTGAAGAAGACAATTGCAGCGATCTTTTCTGTTCTGGTGCTTTCAACAGTATTAACTGCCTGCAACACCACGCGTGGCGTTGGTGAAGACATTTCTGATGGCGGTAACGCGATTTCTGGCGCAGCAACGAAAGCGCAGCAATAA |
| Sequence | MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ |
| Source of smORF | Swiss-Prot |
| Function | Plays a role in the bacteriolysis. Is activated under conditions of high osmolarity by the factor sigma S. Entericidin A functions as an antidote (By similarity). {ECO:0000250}. |
| Pubmed ID | 12384590 12704152 |
| Domain | CDD:400433,CDD:304653 |
| Functional Category | Others |
| Uniprot ID | P0ADC0 |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 126
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5230961 | 5231107 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 5230725 | 5230850 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 4376553 | 4376699 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 4376317 | 4376442 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 5 | 4480939 | 4481085 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 6 | 4480703 | 4480828 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 7 | 3296309 | 3296455 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 8 | 3296073 | 3296198 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 9 | 402534 | 402680 | + | NZ_LR134340.1 | Escherichia marmotae |
| 10 | 3874750 | 3874896 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 11 | 3875007 | 3875132 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 12 | 619273 | 619419 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 13 | 3591979 | 3592125 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 14 | 444770 | 444916 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 15 | 4580495 | 4580641 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 16 | 4580253 | 4580387 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 17 | 2360620 | 2360766 | + | NZ_CP053416.1 | Salmonella bongori |
| 18 | 392304 | 392450 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 19 | 2936001 | 2936147 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 20 | 4415015 | 4415161 | + | NZ_AP014857.1 | Escherichia albertii |
| 21 | 431850 | 431996 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 22 | 3125618 | 3125764 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 23 | 3873827 | 3873973 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 24 | 3873586 | 3873720 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 25 | 1910386 | 1910532 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 26 | 507870 | 508016 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 27 | 3170521 | 3170667 | + | NZ_CP033744.1 | Citrobacter freundii |
| 28 | 406748 | 406894 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 29 | 2940821 | 2940967 | - | NZ_CP038469.1 | Citrobacter tructae |
| 30 | 2193437 | 2193583 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 31 | 415865 | 416011 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 32 | 405133 | 405279 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 33 | 3388869 | 3389015 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 34 | 4229639 | 4229785 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 35 | 3426172 | 3426318 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 36 | 4920053 | 4920199 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 37 | 3488180 | 3488326 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 38 | 397751 | 397897 | + | NC_015968.1 | Enterobacter soli |
| 39 | 4759480 | 4759626 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 40 | 159067 | 159213 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 41 | 3828032 | 3828178 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 42 | 3751576 | 3751722 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 43 | 4235768 | 4235914 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 44 | 4414126 | 4414272 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 45 | 1259329 | 1259475 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 46 | 4124483 | 4124629 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 47 | 12967 | 13113 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 48 | 2698346 | 2698492 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 49 | 4788899 | 4789045 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 50 | 5071378 | 5071524 | - | NZ_CP054254.1 | Klebsiella variicola |
| 51 | 3919996 | 3920142 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 52 | 214618 | 214764 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 53 | 359988 | 360134 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 54 | 3932498 | 3932644 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 55 | 5159195 | 5159341 | - | NZ_CP050508.1 | Raoultella terrigena |
| 56 | 5556716 | 5556862 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 57 | 5701159 | 5701305 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 58 | 5138005 | 5138151 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 59 | 2180216 | 2180362 | + | NZ_CP026047.1 | Raoultella planticola |
| 60 | 4852900 | 4853046 | - | NZ_CP041247.1 | Raoultella electrica |
| 61 | 423223 | 423369 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 62 | 4472653 | 4472799 | - | NZ_CP023525.1 | Cedecea neteri |
| 63 | 4178350 | 4178496 | - | NZ_LR134201.1 | Cedecea lapagei |
| 64 | 4049975 | 4050121 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 65 | 4149028 | 4149174 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 66 | 1418061 | 1418207 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 67 | 1048296 | 1048442 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 68 | 1691644 | 1691790 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 69 | 384763 | 384897 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 70 | 384529 | 384660 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 71 | 3695213 | 3695347 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 72 | 3695449 | 3695580 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 73 | 3685872 | 3686006 | - | NZ_CP038853.1 | Pantoea vagans |
| 74 | 3686109 | 3686240 | - | NZ_CP038853.1 | Pantoea vagans |
| 75 | 4085285 | 4085419 | + | NZ_CP067057.1 | Rahnella aceris |
| 76 | 3778066 | 3778200 | - | NZ_CP061511.1 | Mixta calida |
| 77 | 3778315 | 3778446 | - | NZ_CP061511.1 | Mixta calida |
| 78 | 4000773 | 4000907 | - | NZ_CP026377.1 | Mixta gaviniae |
| 79 | 4001021 | 4001152 | - | NZ_CP026377.1 | Mixta gaviniae |
| 80 | 3144964 | 3145098 | - | NZ_CP028271.1 | Mixta intestinalis |
| 81 | 2088352 | 2088486 | + | NZ_CP019706.1 | Pantoea alhagi |
| 82 | 3304723 | 3304857 | + | NZ_CP049115.1 | Pantoea stewartii |
| 83 | 4103364 | 4103498 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 84 | 4688113 | 4688244 | - | NZ_CP071320.1 | Serratia ureilytica |
| 85 | 347843 | 347974 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 86 | 481267 | 481398 | + | NZ_LT906479.1 | Serratia ficaria |
| 87 | 4817792 | 4817923 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 88 | 4851342 | 4851473 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 89 | 13320 | 13451 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 90 | 337282 | 337413 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 91 | 3666549 | 3666683 | - | NZ_CP015581.1 | Tatumella citrea |
| 92 | 338905 | 339036 | + | NZ_LR134494.1 | Serratia quinivorans |
| 93 | 538716 | 538847 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 94 | 398891 | 399022 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 95 | 3717353 | 3717499 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 96 | 2252797 | 2252931 | + | NZ_LR134531.1 | Pragia fontium |
| 97 | 490623 | 490754 | + | NZ_CP043727.1 | Yersinia canariae |
| 98 | 4248089 | 4248220 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 99 | 4235970 | 4236101 | - | NZ_CP046293.1 | Yersinia intermedia |
| 100 | 2295822 | 2295953 | + | NZ_CP011254.1 | Serratia fonticola |
| 101 | 3137526 | 3137657 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 102 | 3367998 | 3368129 | - | NZ_CP034035.1 | Brenneria rubrifaciens |
| 103 | 4316522 | 4316653 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 104 | 3322777 | 3322908 | + | NZ_CP009787.1 | Yersinia rohdei |
| 105 | 4180286 | 4180417 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 106 | 2188188 | 2188319 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 107 | 530408 | 530539 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 108 | 4343262 | 4343393 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 109 | 3156373 | 3156504 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 110 | 1085969 | 1086100 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 111 | 488245 | 488376 | + | NZ_CP050150.1 | Hafnia alvei |
| 112 | 2930255 | 2930386 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 113 | 3351600 | 3351734 | - | NZ_LN907827.1 | Erwinia gerundensis |
| 114 | 575904 | 576035 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 115 | 2358642 | 2358794 | + | NZ_CP071766.1 | Acinetobacter towneri |
| 116 | 4786638 | 4786769 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 117 | 2138661 | 2138795 | + | NZ_CP035901.1 | Burkholderia glumae |
| 118 | 1880801 | 1880932 | + | NZ_CP065640.1 | Serratia rubidaea |
| 119 | 2043126 | 2043260 | - | NZ_CP013403.1 | Burkholderia metallica |
| 120 | 1182683 | 1182817 | + | NZ_CP002581.1 | Burkholderia plantarii |
| 121 | 2346695 | 2346826 | - | NZ_CP029736.1 | Providencia rettgeri |
| 122 | 2364518 | 2364652 | - | NZ_CP020738.1 | Paraburkholderia acidophila |
| 123 | 597244 | 597378 | + | NZ_CP009793.1 | Burkholderia dolosa AU0158 |
| 124 | 2140064 | 2140198 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 125 | 2055795 | 2055923 | + | NZ_CP029185.2 | Limnobaculum parvum |
| 126 | 1009065 | 1009199 | + | NC_007511.1 | Burkholderia lata |
| 127 | 783669 | 783812 | - | NC_005966.1 | Acinetobacter baylyi ADP1 |
| 128 | 3180346 | 3180483 | + | NZ_CP033219.1 | Parasedimentitalea marina |
| 129 | 520581 | 520715 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 130 | 2308872 | 2309003 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 131 | 4058019 | 4058150 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 132 | 600088 | 600213 | + | NZ_CP027669.1 | Simplicispira suum |
| 133 | 2878849 | 2878980 | - | NZ_CP016440.1 | Bordetella pseudohinzii |
| 134 | 2499786 | 2499917 | - | NC_010645.1 | Bordetella avium 197N |
| 135 | 241251 | 241385 | - | NZ_CP065135.1 | Halomonas venusta |
| 136 | 252136 | 252270 | - | NZ_AP022843.1 | Halomonas hydrothermalis |
| 137 | 1072381 | 1072509 | - | NZ_CP019240.1 | Rhodoferax antarcticus |
| 138 | 1437210 | 1437350 | - | NZ_CP059569.1 | Kingella oralis |
| 139 | 2928468 | 2928593 | + | NZ_CP021359.1 | Acidovorax carolinensis |
| 140 | 2967865 | 2968008 | + | NZ_CP023705.1 | Sphingomonas melonis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13698.8 | 0.69 | 87 | 2048.5 | same-strand | Domain of unknown function (DUF4156) |
| 2 | PF09285.13 | 0.82 | 103 | 295.5 | same-strand | Elongation factor P, C-terminal |
| 3 | PF08207.14 | 0.82 | 103 | 295.5 | same-strand | Elongation factor P (EF-P) KOW-like domain |
| 4 | PF01132.22 | 0.82 | 103 | 295.5 | same-strand | Elongation factor P (EF-P) OB domain |
| 5 | PF08212.14 | 0.73 | 92 | 586 | opposite-strand | Lipocalin-like domain |
| 6 | PF00061.25 | 0.73 | 92 | 586 | opposite-strand | Lipocalin / cytosolic fatty-acid binding protein family |
| 7 | PF02313.19 | 0.62 | 78 | 1421 | opposite-strand | Fumarate reductase subunit D |
| 8 | PF02300.19 | 0.6 | 76 | 1660.0 | opposite-strand | Fumarate reductase subunit C |
++ More..