| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | pyr operon leader peptide (pyrBI operon attenuator) |
| NCBI Accession ID | AE005174.2 |
| Organism | Escherichia coli O157:H7 |
| Left | 5357922 |
| Right | 5358056 |
| Strand | - |
| Nucleotide Sequence | ATGGTTCAGTGTGTTCGACATTTTGTCTTACCGCGTCTGAAAAAAGACGCTGGCCTGCCGTTTTTCTTCCCGTTGATCACCCATTCCCAGCCCCTCAATCGAGGGGCTTTTTTTTGCCCAGGCGTCAGGAGATAA |
| Sequence | MVQCVRHFVLPRLKKDAGLPFFFPLITHSQPLNRGAFFCPGVRR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23981. Profile Description: PyrBI operon leader peptide. This family consists of the pyrBI operon leader peptides. The expression of the pyrBI operon, which encodes the subunits of the pyrimidine biosynthetic enzyme aspartate transcarbamylase. is regulated primarily through a UTP-sensitive transcriptional attenuation control mechanism. In this mechanism, the concentration of UTP determines the extent of coupling between transcription and translation within the pyrBI leader region, hence determining the level of rho-independent transcriptional termination at an attenuator preceding the pyrB gene. |
| Pubmed ID | 11206551 11258796 |
| Domain | CDD:305138 |
| Functional Category | Others |
| Uniprot ID | P0AD85 |
| ORF Length (Amino Acid) | 44 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5328064 | 5328198 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 4472399 | 4472533 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 3988072 | 3988206 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 512351 | 512485 | - | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 4519368 | 4519502 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 4414584 | 4414718 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 7 | 3314450 | 3314584 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 8 | 2811050 | 2811184 | + | NZ_CP038469.1 | Citrobacter tructae |
| 9 | 527589 | 527726 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 10 | 4030829 | 4030966 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 11 | 3999490 | 3999636 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 12 | 3704025 | 3704171 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 13 | 556804 | 556950 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 14 | 4294739 | 4294858 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 15 | 4126512 | 4126658 | + | NZ_CP035129.1 | Kosakonia cowanii |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00122.22 | 0.79 | 11 | 2344.0 | opposite-strand | E1-E2 ATPase |
| 2 | PF00702.28 | 0.79 | 11 | 2344.0 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 3 | PF00690.28 | 0.79 | 11 | 2344.0 | opposite-strand | Cation transporter/ATPase, N-terminus |
| 4 | PF00689.23 | 0.79 | 11 | 2344.0 | opposite-strand | Cation transporting ATPase, C-terminus |
| 5 | PF01042.23 | 1.0 | 14 | 1486 | same-strand | Endoribonuclease L-PSP |
| 6 | PF01948.20 | 1.0 | 14 | 951 | same-strand | Aspartate carbamoyltransferase regulatory chain, allosteric domain |
| 7 | PF02748.17 | 1.0 | 14 | 951 | same-strand | Aspartate carbamoyltransferase regulatory chain, metal binding domain |
| 8 | PF02729.23 | 1.0 | 14 | 4 | same-strand | Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain |
| 9 | PF00185.26 | 1.0 | 14 | 4 | same-strand | Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain |
| 10 | PF04074.14 | 0.64 | 9 | 269.5 | opposite-strand | YhcH/YjgK/YiaL |