Result : P0AD11
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YecJ |
| NCBI Accession ID | AE014075.1 |
| Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Left | 2136183 |
| Right | 2136434 |
| Strand | - |
| Nucleotide Sequence | ATGTCCCAGCCACTGAATGCCGATCAGGAACTGGTTTCTGATGTGGTTGCTTGCCAGTTGGTTATCAAACAAATTCTGGATGTTCTCGATGTGATCGCGCCCGTTGAAGTTCGCGAAAAAATGTCCAGCCAGCTGAAGAATATCGACTTTACTAACCATCCCGCCGCCGCAGACCCGGTCACCATGCGGGCAATCCAAAAAGCCATCGCGTTGATTGAACTCAAGTTTACCCCACAGGGCGAATCCCATTAA |
| Sequence | MSQPLNADQELVSDVVACQLVIKQILDVLDVIAPVEVREKMSSQLKNIDFTNHPAAADPVTMRAIQKAIALIELKFTPQGESH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10964. Profile Description: Protein of unknown function (DUF2766). This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. |
| Pubmed ID | 12471157 |
| Domain | CDD:371318 |
| Functional Category | Others |
| Uniprot ID | P0AD11 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 86
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2562489 | 2562740 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 1987507 | 1987758 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1983791 | 1984042 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 2551726 | 2551977 | - | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 1918310 | 1918561 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 2588797 | 2589048 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 7 | 2075967 | 2076218 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 8 | 1028115 | 1028366 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 9 | 4236959 | 4237210 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 10 | 2700033 | 2700284 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 11 | 39067 | 39318 | - | NZ_CP053416.1 | Salmonella bongori |
| 12 | 1637048 | 1637299 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 13 | 688407 | 688658 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 14 | 2881012 | 2881263 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 15 | 2814539 | 2814790 | - | NC_015968.1 | Enterobacter soli |
| 16 | 604111 | 604362 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 17 | 2860920 | 2861171 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 18 | 2881863 | 2882114 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 19 | 3081093 | 3081344 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 20 | 2105766 | 2106017 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 21 | 4401951 | 4402202 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 22 | 695763 | 696014 | - | NZ_CP033744.1 | Citrobacter freundii |
| 23 | 1484253 | 1484504 | - | NZ_CP038469.1 | Citrobacter tructae |
| 24 | 2971624 | 2971875 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 25 | 4437800 | 4438051 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 26 | 2133586 | 2133837 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 27 | 131519 | 131770 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 28 | 2937357 | 2937608 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 29 | 3070982 | 3071233 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 30 | 1795253 | 1795504 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 31 | 34606 | 34857 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 32 | 1885678 | 1885929 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 33 | 1798993 | 1799244 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 34 | 1733012 | 1733263 | + | NZ_LR134201.1 | Cedecea lapagei |
| 35 | 2273215 | 2273466 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 36 | 1925732 | 1925983 | + | NZ_CP041247.1 | Raoultella electrica |
| 37 | 5279775 | 5280026 | - | NZ_CP026047.1 | Raoultella planticola |
| 38 | 1987283 | 1987534 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 39 | 1946760 | 1947011 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 40 | 1313505 | 1313753 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 41 | 2755617 | 2755868 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 42 | 1813571 | 1813822 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 43 | 1814696 | 1814947 | + | NZ_CP023525.1 | Cedecea neteri |
| 44 | 2037721 | 2037972 | + | NZ_CP050508.1 | Raoultella terrigena |
| 45 | 3398286 | 3398537 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 46 | 1881619 | 1881870 | + | NZ_CP054254.1 | Klebsiella variicola |
| 47 | 2178955 | 2179206 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 48 | 1537867 | 1538115 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 49 | 2646349 | 2646597 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 50 | 4144635 | 4144886 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 51 | 1810461 | 1810712 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 52 | 2606056 | 2606304 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 53 | 2744695 | 2744943 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 54 | 803340 | 803588 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 55 | 1627743 | 1627994 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 56 | 1700882 | 1701136 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 57 | 3106091 | 3106330 | - | NZ_LR134494.1 | Serratia quinivorans |
| 58 | 4084986 | 4085225 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 59 | 692783 | 693022 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 60 | 88240 | 88488 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 61 | 3111195 | 3111434 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 62 | 3099067 | 3099306 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 63 | 5289729 | 5289968 | - | NZ_CP011254.1 | Serratia fonticola |
| 64 | 3640123 | 3640362 | + | NZ_CP007230.1 | Yersinia similis |
| 65 | 2014691 | 2014930 | + | NZ_CP043727.1 | Yersinia canariae |
| 66 | 2613539 | 2613778 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 67 | 4429935 | 4430189 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 68 | 141453 | 141701 | - | NZ_LS483470.1 | Leminorella richardii |
| 69 | 1938115 | 1938360 | - | NZ_CP067057.1 | Rahnella aceris |
| 70 | 3025451 | 3025690 | - | NZ_LT906479.1 | Serratia ficaria |
| 71 | 1470309 | 1470548 | + | NZ_CP032487.1 | Yersinia hibernica |
| 72 | 2297987 | 2298226 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 73 | 2009720 | 2009968 | + | NZ_CP006569.1 | Sodalis praecaptivus |
| 74 | 3000685 | 3000924 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 75 | 2098995 | 2099234 | + | NZ_CP071320.1 | Serratia ureilytica |
| 76 | 1992973 | 1993212 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 77 | 4384183 | 4384422 | - | NZ_CP065640.1 | Serratia rubidaea |
| 78 | 3204289 | 3204528 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 79 | 861051 | 861290 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 80 | 943239 | 943478 | - | NZ_CP009787.1 | Yersinia rohdei |
| 81 | 5038110 | 5038349 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 82 | 2582067 | 2582306 | - | NZ_CP046293.1 | Yersinia intermedia |
| 83 | 2470901 | 2471146 | - | NZ_CP050150.1 | Hafnia alvei |
| 84 | 2115342 | 2115593 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 85 | 1655830 | 1656081 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 86 | 166502 | 166753 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 87 | 3562034 | 3562285 | + | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061527.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00210.26 | 0.64 | 55 | 1881.0 | opposite-strand | Ferritin-like domain |
++ More..