Result : P0ACY0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YdiE |
| NCBI Accession ID | AE005174.2 |
| Organism | Escherichia coli O157:H7 |
| Left | 2464528 |
| Right | 2464719 |
| Strand | + |
| Nucleotide Sequence | ATGCGTTATACGGATAGCAGAAAACTCACGCCTGAAACGGATGCCAATCACAAGACCGCTTCCCCGCAGCCTATTCGGCGAATTTCCAGCCAGACACTGTTAGGTCCGGATGGCAAACTGATTATCGATCATGACGGGCAAGAATATCTGCTCCGTAAAACTCAGGCTGGCAAGCTGCTGTTGACCAAGTAG |
| Sequence | MRYTDSRKLTPETDANHKTASPQPIRRISSQTLLGPDGKLIIDHDGQEYLLRKTQAGKLLLTK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl10043. Profile Description: Hemin uptake protein hemP. hypothetical protein; Provisional |
| Pubmed ID | 11206551 11258796 |
| Domain | CDD:415835 |
| Functional Category | Others |
| Uniprot ID | P0ACY0 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 26
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1965349 | 1965540 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 1789613 | 1789804 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 2389464 | 2389655 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 1557204 | 1557395 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 2039727 | 2039918 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 1425041 | 1425232 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 7 | 3836883 | 3837074 | - | NZ_CP053416.1 | Salmonella bongori |
| 8 | 4404159 | 4404347 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 9 | 236849 | 237037 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 10 | 1946923 | 1947105 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 11 | 1151926 | 1152114 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 12 | 1913672 | 1913860 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 13 | 1942049 | 1942231 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 14 | 2696771 | 2696962 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 15 | 1876339 | 1876521 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 16 | 1515278 | 1515466 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 17 | 1434124 | 1434315 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 18 | 816426 | 816614 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 19 | 686109 | 686297 | - | NZ_CP038469.1 | Citrobacter tructae |
| 20 | 612037 | 612219 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 21 | 2529005 | 2529190 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 22 | 1013813 | 1013998 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 23 | 3116125 | 3116316 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 24 | 2157458 | 2157640 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 25 | 4499636 | 4499818 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 26 | 1525515 | 1525688 | - | NZ_LS483422.1 | Providencia heimbachae |
| 27 | 3984923 | 3985105 | - | NZ_LR134531.1 | Pragia fontium |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP019007.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.96 | 25 | 4922.0 | same-strand | ABC transporter |
| 2 | PF13191.8 | 0.73 | 19 | 4929.5 | same-strand | AAA ATPase domain |
| 3 | PF00793.22 | 0.88 | 23 | 161.0 | same-strand | DAHP synthetase I family |
| 4 | PF03618.16 | 0.88 | 23 | 1356.0 | same-strand | Kinase/pyrophosphorylase |
| 5 | PF01326.21 | 0.88 | 23 | 2531.0 | opposite-strand | Pyruvate phosphate dikinase, AMP/ATP-binding domain |
| 6 | PF02896.20 | 0.88 | 23 | 2531.0 | opposite-strand | PEP-utilising enzyme, PEP-binding domain |
| 7 | PF00391.25 | 0.88 | 23 | 2531.0 | opposite-strand | PEP-utilising enzyme, mobile domain |
| 8 | PF01032.20 | 0.62 | 16 | 3954.0 | same-strand | FecCD transport family |
| 9 | PF01497.20 | 0.62 | 16 | 3133.0 | same-strand | Periplasmic binding protein |
| 10 | PF05171.14 | 0.62 | 16 | 2108.0 | same-strand | Haemin-degrading HemS.ChuX domain |
| 11 | PF06228.15 | 0.62 | 16 | 2108.0 | same-strand | Haem utilisation ChuX/HutX |
| 12 | PF00593.26 | 0.62 | 16 | 77.0 | same-strand | TonB dependent receptor |
| 13 | PF07715.17 | 0.62 | 16 | 77.0 | same-strand | TonB-dependent Receptor Plug Domain |
++ More..