Result : P0ACW9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YdfA |
| NCBI Accession ID | AE005174.2 |
| Organism | Escherichia coli O157:H7 |
| Left | 1256247 |
| Right | 1256402 |
| Strand | - |
| Nucleotide Sequence | ATGGATACTATCGATCTTGGCAACAACGAATCTCTGGTGTACGGCGTGTTTCCCAACCAGGACGGTACATTCACCGCGATGACGTATACCAAAAGCAAAACGTTTAAAACCGAAAATGGTGCCCGTCGCTGGCTGGAAAGAAACTCAGGTGAGTGA |
| Sequence | MDTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNSGE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam07151. Profile Description: Protein of unknown function (DUF1391). This family consists of several Enterobacterial proteins of around 50 residues in length. Members of this family are found in Escherichia coli and Salmonella typhi where they are often known as YdfA. The function of this family is unknown. |
| Pubmed ID | 11206551 11258796 |
| Domain | CDD:369233 |
| Functional Category | Others |
| Uniprot ID | P0ACW9 |
| ORF Length (Amino Acid) | 51 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1648508 | 1648663 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1419156 | 1419311 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1167023 | 1167178 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 1544337 | 1544489 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 2200230 | 2200382 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 6 | 1928764 | 1928919 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 7 | 2707262 | 2707414 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 8 | 910920 | 911075 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 9 | 2014598 | 2014750 | + | NZ_AP014857.1 | Escherichia albertii |
| 10 | 1329108 | 1329260 | - | NZ_AP014857.1 | Escherichia albertii |
| 11 | 2338725 | 2338880 | + | NZ_LR134340.1 | Escherichia marmotae |
| 12 | 3052997 | 3053149 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 13 | 1546247 | 1546387 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14549.8 | 0.83 | 5 | 682.5 | opposite-strand | DNA-binding transcriptional regulator Cro |
| 2 | PF01381.24 | 1.0 | 6 | 239.0 | same-strand | Helix-turn-helix |
| 3 | PF12844.9 | 0.83 | 5 | 198.0 | same-strand | Helix-turn-helix domain |
| 4 | PF13560.8 | 1.0 | 6 | 203 | same-strand | Helix-turn-helix domain |
++ More..