Result : P0ACW5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YdcA |
| NCBI Accession ID | AE005674.2 |
| Organism | Shigella flexneri |
| Left | 1830082 |
| Right | 1830255 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAAACTGGCACTTATTTTGTTTATGGGAACGCTTGTTTCCTTTTATGCCGATGCCGGGCGCAAACCCTGTTCTGGTTCGAAAGGGGGGATCTCACACTGTACGGCAGGCGGCAAATTTGTCTGTAATGATGGTTCTATTAGTGCATCGAAAAAAACATGCACTAACTGA |
| Sequence | MKKLALILFMGTLVSFYADAGRKPCSGSKGGISHCTAGGKFVCNDGSISASKKTCTN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of PRK10040. Profile Description: hypothetical protein; Provisional |
| Pubmed ID | 12384590 12704152 |
| Domain | CDD:182205 |
| Functional Category | Others |
| Uniprot ID | P0ACW5 |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1830082 | 1830255 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 1491677 | 1491850 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 2009323 | 2009496 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 2000227 | 2000400 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 2272912 | 2273085 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 630205 | 630387 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 7 | 396367 | 396516 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 8 | 1283912 | 1284076 | + | NZ_LT906479.1 | Serratia ficaria |
| 9 | 892224 | 892403 | - | NZ_CP031700.1 | Neisseria zalophi |
| 10 | 1290478 | 1290651 | - | NZ_CP014136.1 | Gibbsiella quercinecans |
| 11 | 879902 | 880066 | - | NZ_AP014857.1 | Escherichia albertii |
| 12 | 1427067 | 1427207 | + | NZ_CP054840.1 | Acidovorax antarcticus |
| 13 | 1127975 | 1128139 | + | NZ_CP054840.1 | Acidovorax antarcticus |
| 14 | 1788629 | 1788772 | - | NZ_CP007446.1 | Snodgrassella alvi wkB2 |
| 15 | 935104 | 935283 | + | NZ_CP014945.1 | Psychrobacter alimentarius |
| 16 | 314777 | 314917 | + | NZ_CP012678.1 | Psychrobacter urativorans |
| 17 | 2296420 | 2296563 | + | NZ_CP012678.1 | Psychrobacter urativorans |
| 18 | 2725657 | 2725833 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 19 | 3182467 | 3182610 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 20 | 1180232 | 1180375 | + | NC_007204.1 | Psychrobacter arcticus 273-4 |
| 21 | 914266 | 914406 | - | NZ_LR884459.1 | Psychrobacter arenosus |
++ More..