Result : P0ACV8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YmjA |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1357423 |
| Right | 1357668 |
| Strand | - |
| Nucleotide Sequence | ATGAACCACGATATCCCGCTAAAATATTTTGATATTGCCGATGAGTACGCGACCGAATGCGCAGAGCCTGTCGCAGAGGCTGAACGCACACCGCTGGCCCACTACTTCCAGTTACTGCTCACCCGTTTGATGAACAATGAAGAGATCAGCGAAGAAGCCCAACATGAAATGGCTGCTGAAGCGGGGATTAATCCCGTACGCATTGATGAGATCGCAGAGTTTTTGAATCAATGGGGTAATGAGTAA |
| Sequence | MNHDIPLKYFDIADEYATECAEPVAEAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAEAGINPVRIDEIAEFLNQWGNE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10820. Profile Description: Protein of unknown function (DUF2543). This family of proteins with unknown function appear to be restricted to Enterobacteriaceae. The family has a highly conserved sequence. |
| Pubmed ID | 9278503 16738553 |
| Domain | CDD:402446 |
| Functional Category | Others |
| Uniprot ID | P0ACV8 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 71
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1351695 | 1351940 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 1357423 | 1357668 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 2108874 | 2109119 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 1865493 | 1865738 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 1420806 | 1421051 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 2371757 | 2372002 | + | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 3378820 | 3379065 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 8 | 3159663 | 3159908 | + | NZ_CP041247.1 | Raoultella electrica |
| 9 | 3093327 | 3093572 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 10 | 3867408 | 3867653 | - | NZ_CP026047.1 | Raoultella planticola |
| 11 | 1815803 | 1816048 | + | NC_015968.1 | Enterobacter soli |
| 12 | 972501 | 972746 | - | NZ_CP038853.1 | Pantoea vagans |
| 13 | 4757984 | 4758229 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 14 | 596574 | 596819 | + | NZ_CP017482.1 | Pectobacterium polaris |
| 15 | 997099 | 997344 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 16 | 2148386 | 2148631 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 17 | 1930065 | 1930310 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 18 | 2073606 | 2073851 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 19 | 1842617 | 1842862 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 20 | 985101 | 985346 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
| 21 | 3395154 | 3395399 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 22 | 1729770 | 1730015 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 23 | 1225970 | 1226215 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 24 | 3423577 | 3423822 | + | NZ_LS483470.1 | Leminorella richardii |
| 25 | 1808166 | 1808411 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 26 | 701752 | 701997 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 27 | 4691085 | 4691330 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
| 28 | 1971910 | 1972155 | - | NZ_CP026377.1 | Mixta gaviniae |
| 29 | 4273152 | 4273397 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 30 | 2836726 | 2836971 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 31 | 3257970 | 3258215 | - | NZ_CP065044.1 | Pectobacterium aroidearum |
| 32 | 1668806 | 1669051 | - | NZ_LN907827.1 | Erwinia gerundensis |
| 33 | 2296372 | 2296617 | - | NZ_CP038469.1 | Citrobacter tructae |
| 34 | 1792421 | 1792666 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 35 | 3602961 | 3603206 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 36 | 4894264 | 4894509 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 37 | 1263344 | 1263589 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 38 | 3935903 | 3936148 | + | NZ_CP019706.1 | Pantoea alhagi |
| 39 | 1566038 | 1566283 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 40 | 1059060 | 1059305 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 41 | 1924877 | 1925122 | - | NZ_CP061511.1 | Mixta calida |
| 42 | 120357 | 120602 | + | NZ_CP012265.1 | Cronobacter condimenti 1330 |
| 43 | 3854120 | 3854365 | + | NZ_CP033744.1 | Citrobacter freundii |
| 44 | 1816144 | 1816389 | + | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 45 | 3089358 | 3089603 | - | NZ_CP051652.1 | Pectobacterium carotovorum |
| 46 | 1242950 | 1243195 | - | NZ_LR134201.1 | Cedecea lapagei |
| 47 | 1652568 | 1652813 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 48 | 2731755 | 2732003 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 49 | 3536747 | 3536992 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 50 | 3633866 | 3634111 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 51 | 1271153 | 1271398 | - | NZ_CP023525.1 | Cedecea neteri |
| 52 | 63000 | 63245 | + | NZ_CP049260.1 | Cronobacter sakazakii |
| 53 | 43834 | 44079 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 54 | 2530633 | 2530878 | - | NZ_CP050150.1 | Hafnia alvei |
| 55 | 94800 | 95045 | + | NZ_CP013941.1 | Cronobacter malonaticus LMG 23826 |
| 56 | 97399 | 97644 | - | NZ_CP012258.1 | Cronobacter universalis NCTC 9529 |
| 57 | 3023780 | 3024025 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 58 | 61910 | 62158 | - | NZ_CP049115.1 | Pantoea stewartii |
| 59 | 48730 | 48975 | + | NZ_CP012267.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 60 | 1836608 | 1836853 | + | NZ_CP034938.1 | Pectobacterium odoriferum |
| 61 | 2367077 | 2367322 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 62 | 1825101 | 1825346 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 63 | 2927460 | 2927705 | - | NZ_CP050508.1 | Raoultella terrigena |
| 64 | 3105181 | 3105426 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 65 | 2514808 | 2515053 | - | NZ_CP054254.1 | Klebsiella variicola |
| 66 | 2812036 | 2812281 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 67 | 2425578 | 2425823 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 68 | 3819896 | 3820141 | - | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 69 | 1433910 | 1434155 | - | NZ_CP026364.1 | Proteus hauseri |
| 70 | 3027005 | 3027250 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 71 | 1857883 | 1858128 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 72 | 2646406 | 2646615 | + | NZ_CP015581.1 | Tatumella citrea |
++ More..