ProsmORF-pred
Result : P0ACH1
Protein Information
Information Type Description
Protein name Sugar fermentation stimulation protein B (Ner-like protein)
NCBI Accession ID X68873.1
Organism Escherichia coli (strain K12)
Left 627
Right 905
Strand +
Nucleotide Sequence ATGGAAAGTAATTTCATTGACTGGCATCCCGCTGACATCATTGCGGGTTTGCGCAAGAAGGGAACGTCAATGGCGGCGGAATCTCGCAGAAATGGTTTGAGTTCCTCAACGCTGGCGAATGCATTATCGCGCCCATGGCCGAAAGGAGAGATGATTATTGCGAAAGCCCTGGGAACTGACCCCTGGGTTATCTGGCCATCACGCTACCATGATCCGCAGACCCATGAGTTTATCGACAGAACGCAGTTGATGCGTAGCTACACTAAACCGAAAAAATGA
Sequence MESNFIDWHPADIIAGLRKKGTSMAAESRRNGLSSSTLANALSRPWPKGEMIIAKALGTDPWVIWPSRYHDPQTHEFIDRTQLMRSYTKPKK
Source of smORF Swiss-Prot
Function This protein is involved in positive regulation of the metabolism of sugars. {ECO:0000250}.
Pubmed ID 2670911 9278503 16738553
Domain CDD:419869
Functional Category DNA-binding
Uniprot ID P0ACH1
ORF Length (Amino Acid) 92
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 148
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 3327089 3327367 + NC_004337.2 Shigella flexneri 2a str. 301
2 3334909 3335187 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
3 481674 481952 - NZ_CP061527.1 Shigella dysenteriae
4 3318468 3318746 + NZ_AP014857.1 Escherichia albertii
5 4077390 4077668 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
6 3840062 3840340 + NZ_LR134340.1 Escherichia marmotae
7 3474557 3474844 + NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
8 1329497 1329769 + NZ_CP053416.1 Salmonella bongori
9 2259591 2259872 + NZ_CP057657.1 Escherichia fergusonii
10 2940678 2940962 - NZ_CP044098.1 Citrobacter portucalensis
11 4238230 4238502 + NC_009792.1 Citrobacter koseri ATCC BAA-895
12 5357912 5358199 + NZ_CP045205.1 Citrobacter telavivensis
13 2140518 2140802 + NZ_CP033744.1 Citrobacter freundii
14 1767334 1767621 - NZ_LT556085.1 Citrobacter amalonaticus
15 3938708 3938992 - NZ_CP038469.1 Citrobacter tructae
16 4885265 4885552 - NC_013716.1 Citrobacter rodentium ICC168
17 615656 615928 - NZ_CP060111.1 Klebsiella michiganensis
18 3654787 3655062 - NZ_CP045300.1 Kosakonia arachidis
19 4481285 4481533 + NZ_CP045300.1 Kosakonia arachidis
20 654283 654555 - NZ_CP036175.1 Klebsiella huaxiensis
21 522075 522347 - NZ_LR134475.1 Klebsiella aerogenes
22 1088799 1089071 - NZ_CP051548.1 Phytobacter diazotrophicus
23 4775053 4775328 + NZ_CP015113.1 Kosakonia radicincitans
24 3732655 3732930 - NZ_CP015113.1 Kosakonia radicincitans
25 548937 549212 - NZ_CP014007.2 Kosakonia oryzae
26 1431435 1431683 + NZ_CP014007.2 Kosakonia oryzae
27 513731 514003 - NZ_CP041247.1 Raoultella electrica
28 4639742 4639987 - NZ_CP041247.1 Raoultella electrica
29 4076580 4076849 + NZ_CP012871.1 [Enterobacter] lignolyticus
30 586211 586465 - NZ_CP012871.1 [Enterobacter] lignolyticus
31 1362159 1362416 - NZ_CP012871.1 [Enterobacter] lignolyticus
32 4179487 4179759 - NZ_CP045769.1 Enterobacter cancerogenus
33 5251577 5251849 - NZ_CP011602.1 Phytobacter ursingii
34 2874439 2874726 + NZ_CP023529.1 Lelliottia amnigena
35 1906982 1907269 + NZ_AP019007.1 Enterobacter oligotrophicus
36 525920 526192 - NZ_CP065838.1 Klebsiella quasipneumoniae
37 539639 539911 - NZ_CP054254.1 Klebsiella variicola
38 2597569 2597844 + NZ_CP016337.1 Kosakonia sacchari
39 1702798 1703052 + NZ_CP016337.1 Kosakonia sacchari
40 1159142 1159369 + NZ_CP026047.1 Raoultella planticola
41 2355882 2356127 + NZ_CP026047.1 Raoultella planticola
42 564043 564270 - NZ_CP046672.1 Raoultella ornithinolytica
43 4912350 4912592 - NZ_CP046672.1 Raoultella ornithinolytica
44 4753817 4754089 + NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
45 3700685 3700948 + NZ_CP013940.1 Cronobacter malonaticus LMG 23826
46 559542 559814 - NZ_CP045845.1 Kluyvera intermedia
47 532325 532597 - NZ_CP050508.1 Raoultella terrigena
48 2976247 2976510 + NZ_CP027107.1 Cronobacter sakazakii
49 2840123 2840374 + NZ_CP027107.1 Cronobacter sakazakii
50 4168901 4169188 + NC_015968.1 Enterobacter soli
51 4347636 4347911 + NZ_CP063425.1 Kosakonia pseudosacchari
52 4277873 4278160 + NZ_CP009756.1 Enterobacter cloacae
53 4082938 4083225 + NZ_AP022508.1 Enterobacter bugandensis
54 465926 466189 - NZ_CP012264.1 Cronobacter condimenti 1330
55 3575966 3576229 + NZ_CP012268.1 Cronobacter muytjensii ATCC 51329
56 462851 463114 - NZ_CP012266.1 Cronobacter dublinensis subsp. dublinensis LMG 23823
57 499639 499863 - NZ_CP054058.1 Scandinavium goeteborgense
58 4000189 4000434 - NZ_CP054058.1 Scandinavium goeteborgense
59 969649 969963 - NZ_CP054058.1 Scandinavium goeteborgense
60 508123 508398 - NZ_CP035129.1 Kosakonia cowanii
61 3336913 3337167 + NZ_CP035129.1 Kosakonia cowanii
62 4158023 4158310 + NZ_CP027986.1 Enterobacter sichuanensis
63 4171908 4172195 + NZ_CP017184.1 Enterobacter roggenkampii
64 4230139 4230426 - NZ_CP017279.1 Enterobacter ludwigii
65 568607 568891 - NZ_CP013990.1 Leclercia adecarboxylata
66 450749 451012 - NZ_CP012257.1 Cronobacter universalis NCTC 9529
67 3133163 3133450 - NZ_CP025034.2 Enterobacter sp. SGAir0187
68 4511922 4512209 + NZ_CP043318.1 Enterobacter chengduensis
69 333552 333815 - NZ_CP023525.1 Cedecea neteri
70 439324 439599 - NZ_CP023525.1 Cedecea neteri
71 1138544 1138810 + NZ_CP042941.1 Atlantibacter hermannii
72 400155 400427 - NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
73 334197 334466 + NZ_CP020388.1 Pluralibacter gergoviae
74 500351 500614 - NZ_AP023184.1 Buttiauxella agrestis
75 1056753 1057040 - NZ_AP023184.1 Buttiauxella agrestis
76 612180 612443 + NZ_CP040428.1 Jejubacter calystegiae
77 336783 337046 - NZ_LR134201.1 Cedecea lapagei
78 668171 668452 - NZ_CP031560.1 Dickeya dianthicola
79 896543 896830 - NZ_CP031560.1 Dickeya dianthicola
80 463561 463827 + NZ_CP031560.1 Dickeya dianthicola
81 125154 125411 + NZ_CP031560.1 Dickeya dianthicola
82 2828845 2829126 - NZ_CP015137.1 Dickeya solani IPO 2222
83 3060737 3061024 - NZ_CP015137.1 Dickeya solani IPO 2222
84 2309800 2310057 + NZ_CP015137.1 Dickeya solani IPO 2222
85 645824 646105 - NZ_CP025799.1 Dickeya zeae
86 917263 917547 - NZ_CP025799.1 Dickeya zeae
87 1680689 1680958 + NZ_CP025799.1 Dickeya zeae
88 784713 784967 - NZ_CP025799.1 Dickeya zeae
89 4459195 4459452 - NZ_CP025799.1 Dickeya zeae
90 3708817 3709098 + NZ_CP042220.2 Dickeya poaceiphila
91 3509582 3509869 + NZ_CP042220.2 Dickeya poaceiphila
92 2707548 2707778 + NZ_CP042220.2 Dickeya poaceiphila
93 3933552 3933818 - NZ_CP042220.2 Dickeya poaceiphila
94 659028 659309 - NC_014500.1 Dickeya dadantii 3937
95 972559 972846 - NC_014500.1 Dickeya dadantii 3937
96 3139904 3140191 - NC_014500.1 Dickeya dadantii 3937
97 462414 462680 - NC_014500.1 Dickeya dadantii 3937
98 4698340 4698597 - NC_014500.1 Dickeya dadantii 3937
99 2124236 2124517 + NZ_CP009460.1 Dickeya fangzhongdai
100 1848400 1848687 + NZ_CP009460.1 Dickeya fangzhongdai
101 1727545 1727793 - NZ_CP009460.1 Dickeya fangzhongdai
102 407721 407981 - NZ_CP038662.1 Serratia nematodiphila
103 3547635 3547898 + NZ_CP014137.1 Brenneria goodwinii
104 3301260 3301505 + NZ_CP014137.1 Brenneria goodwinii
105 4461430 4461675 - NZ_CP014137.1 Brenneria goodwinii
106 3756618 3756890 + NC_012880.1 Musicola paradisiaca Ech703
107 3936526 3936789 + NC_012880.1 Musicola paradisiaca Ech703
108 4117376 4117642 + NC_012880.1 Musicola paradisiaca Ech703
109 4400733 4401008 - NZ_LT615367.1 Dickeya aquatica
110 680402 680671 - NZ_LT615367.1 Dickeya aquatica
111 3955434 3955715 + NC_012912.1 Dickeya chrysanthemi Ech1591
112 3731930 3732217 + NC_012912.1 Dickeya chrysanthemi Ech1591
113 478529 478816 + NC_012912.1 Dickeya chrysanthemi Ech1591
114 4195132 4195398 + NC_012912.1 Dickeya chrysanthemi Ech1591
115 516830 517123 - NZ_LN907827.1 Erwinia gerundensis
116 206814 207104 - NZ_CP015581.1 Tatumella citrea
117 4031329 4031592 + NZ_CP034036.1 Brenneria nigrifluens DSM 30175 = ATCC 13028
118 4878401 4878661 - NZ_CP016948.1 Serratia surfactantfaciens
119 3220131 3220394 + NZ_CP065534.1 Lonsdalea populi
120 3426368 3426634 + NZ_CP065534.1 Lonsdalea populi
121 1676941 1677204 - NZ_CP023009.1 Lonsdalea britannica
122 1838771 1839016 - NZ_CP023009.1 Lonsdalea britannica
123 4068962 4069243 + NC_017554.1 Pantoea ananatis PA13
124 398188 398448 - NZ_LR134494.1 Serratia quinivorans
125 947957 948220 + NZ_CP047495.1 Pectobacterium brasiliense
126 4241803 4242066 + NZ_CP065044.1 Pectobacterium aroidearum
127 600443 600697 - NZ_CP065044.1 Pectobacterium aroidearum
128 3203223 3203477 + NZ_CP065044.1 Pectobacterium aroidearum
129 4303656 4303883 - NZ_CP065044.1 Pectobacterium aroidearum
130 601070 601342 - NZ_CP065044.1 Pectobacterium aroidearum
131 1942327 1942587 - NZ_CP065640.1 Serratia rubidaea
132 4628084 4628344 + NZ_CP071320.1 Serratia ureilytica
133 4512804 4513067 - NZ_CP017482.1 Pectobacterium polaris
134 1705962 1706216 + NZ_CP017482.1 Pectobacterium polaris
135 482615 482878 - NZ_CP034035.1 Brenneria rubrifaciens
136 651366 651611 - NZ_CP034035.1 Brenneria rubrifaciens
137 3470054 3470299 + NZ_CP034035.1 Brenneria rubrifaciens
138 4336042 4336317 - NZ_CP028271.1 Mixta intestinalis
139 386695 386955 - NC_013961.1 Erwinia amylovora CFBP1430
140 3339005 3339286 - NZ_CP049115.1 Pantoea stewartii
141 674782 675045 - NZ_CP034938.1 Pectobacterium odoriferum
142 735970 736233 - NZ_CP038498.1 Pectobacterium punjabense
143 640719 640982 - NZ_CP009125.1 Pectobacterium atrosepticum
144 3310010 3310273 + NZ_CP015749.1 Pectobacterium parmentieri
145 2520848 2521111 - NZ_CP015750.1 Pectobacterium wasabiae CFBP 3304
146 4689359 4689613 + NZ_CP015750.1 Pectobacterium wasabiae CFBP 3304
147 1091193 1091459 + NZ_CP019706.1 Pantoea alhagi
148 3979676 3979939 + NZ_CP006569.1 Sodalis praecaptivus
149 4480824 4481075 + NZ_CP067057.1 Rahnella aceris
150 4149173 4149442 - NZ_CP067057.1 Rahnella aceris
151 2132266 2132535 - NZ_CP067057.1 Rahnella aceris
152 458614 458874 - NC_015567.1 Serratia plymuthica AS9
153 500181 500447 - NZ_CP061511.1 Mixta calida
154 386523 386783 - NC_010694.1 Erwinia tasmaniensis Et1/99
155 474597 474890 + NC_010694.1 Erwinia tasmaniensis Et1/99
156 574928 575203 - NZ_CP026377.1 Mixta gaviniae
157 397451 397711 - NZ_CP048784.1 Serratia liquefaciens
158 3584732 3584992 + NZ_CP023567.1 Erwinia pyrifoliae
159 2034609 2034869 + NZ_CP014136.1 Gibbsiella quercinecans
160 2627049 2627294 - NZ_CP014136.1 Gibbsiella quercinecans
161 3846665 3846910 - NZ_CP014136.1 Gibbsiella quercinecans
162 247080 247340 + NZ_CP007044.2 Chania multitudinisentens RB-25
163 540002 540268 - NZ_LT906479.1 Serratia ficaria
164 419118 419402 - NZ_CP034148.1 Pantoea agglomerans
165 2165011 2165244 - NZ_CP006664.1 Edwardsiella anguillarum ET080813
166 3660706 3660990 + NZ_CP045720.1 Pantoea eucalypti
167 1844538 1844804 - NZ_CP026364.1 Proteus hauseri
168 1336308 1336622 - NZ_CP023536.1 Providencia alcalifaciens
169 269483 269749 - NZ_CP047349.1 Proteus terrae subsp. cibarius
170 550097 550408 - NZ_CP050150.1 Hafnia alvei
171 3729354 3729620 - NC_010554.1 Proteus mirabilis HI4320
172 1034308 1034580 - NC_010554.1 Proteus mirabilis HI4320
173 2362049 2362309 - NZ_CP011254.1 Serratia fonticola
174 5306518 5306784 + NC_005126.1 Photorhabdus laumondii subsp. laumondii TTO1
175 1266684 1266932 + NC_005126.1 Photorhabdus laumondii subsp. laumondii TTO1
176 5225791 5226078 - NC_005126.1 Photorhabdus laumondii subsp. laumondii TTO1
177 1085908 1086174 - NC_005126.1 Photorhabdus laumondii subsp. laumondii TTO1
178 4086061 4086330 + NC_005126.1 Photorhabdus laumondii subsp. laumondii TTO1
179 2185431 2185706 - NZ_CP007230.1 Yersinia similis
180 4028955 4029230 + NZ_LR134373.1 Yersinia pseudotuberculosis
181 448609 448842 - NC_012779.2 Edwardsiella ictaluri 93-146
182 4174614 4174889 + NZ_CP046293.1 Yersinia intermedia
183 2380775 2381041 - NZ_CP011104.1 Photorhabdus thracensis
184 657337 657603 - NZ_CP011104.1 Photorhabdus thracensis
185 2811195 2811464 - NZ_CP011104.1 Photorhabdus thracensis
186 791018 791293 + NZ_CP011104.1 Photorhabdus thracensis
187 359414 359671 - NC_013892.1 Xenorhabdus bovienii SS-2004
188 3958303 3958581 - NC_013892.1 Xenorhabdus bovienii SS-2004
189 1498946 1499224 - NC_013892.1 Xenorhabdus bovienii SS-2004
190 3297937 3298215 + NC_013892.1 Xenorhabdus bovienii SS-2004
191 4709690 4709956 + NC_012962.1 Photorhabdus asymbiotica
192 3198494 3198769 - NZ_CP009781.1 Yersinia aldovae 670-83
193 1119473 1119745 - NZ_CP029736.1 Providencia rettgeri
194 3420788 3421060 + NZ_CP031123.2 Providencia huaxiensis
195 1760497 1760736 + NZ_CP031123.2 Providencia huaxiensis
196 489206 489481 - NZ_CP032487.1 Yersinia hibernica
197 434531 434788 - NZ_FO704550.1 Xenorhabdus doucetiae
198 1694479 1694742 + NZ_FO704550.1 Xenorhabdus doucetiae
199 1033702 1033965 - NZ_FO704550.1 Xenorhabdus doucetiae
200 1058324 1058602 + NZ_FO704550.1 Xenorhabdus doucetiae
201 1395477 1395755 + NZ_FO704550.1 Xenorhabdus doucetiae
202 3651369 3651653 + NZ_CP038853.1 Pantoea vagans
203 3346297 3346554 + NZ_FO704551.1 Xenorhabdus poinarii G6
204 1937728 1937991 - NZ_FO704551.1 Xenorhabdus poinarii G6
205 2829461 2829739 - NZ_FO704551.1 Xenorhabdus poinarii G6
206 2545618 2545896 - NZ_FO704551.1 Xenorhabdus poinarii G6
207 2778821 2779048 + NZ_FO704551.1 Xenorhabdus poinarii G6
208 3002666 3002923 + NZ_CP016176.1 Xenorhabdus hominickii
209 2759036 2759305 + NZ_CP016176.1 Xenorhabdus hominickii
210 2729307 2729588 - NZ_CP016176.1 Xenorhabdus hominickii
211 4400478 4400738 + NZ_CP016176.1 Xenorhabdus hominickii
212 4112422 4112679 + NZ_CP016176.1 Xenorhabdus hominickii
213 2639604 2639834 - NZ_CP011078.1 Yersinia ruckeri
214 3016905 3017174 + NZ_CP060401.1 Xenorhabdus nematophila
215 2802597 2802863 - NZ_CP060401.1 Xenorhabdus nematophila
216 345101 345367 + NZ_CP060401.1 Xenorhabdus nematophila
217 315492 315773 - NZ_CP060401.1 Xenorhabdus nematophila
218 2764483 2764749 - NZ_CP060401.1 Xenorhabdus nematophila
219 140741 141019 + NZ_CP060401.1 Xenorhabdus nematophila
220 4035186 4035440 + NZ_CP072455.1 Xenorhabdus budapestensis
221 681483 681755 + NZ_CP072455.1 Xenorhabdus budapestensis
222 3343318 3343599 - NZ_CP072455.1 Xenorhabdus budapestensis
223 655161 655442 - NZ_CP072455.1 Xenorhabdus budapestensis
224 1036102 1036365 + NZ_CP072455.1 Xenorhabdus budapestensis
225 4492186 4492443 + NC_014306.1 Erwinia billingiae Eb661
226 1786606 1786881 - NZ_CP054043.1 Yersinia mollaretii ATCC 43969
227 1687282 1687554 - NZ_CP054043.1 Yersinia mollaretii ATCC 43969
228 1189953 1190198 - NZ_CP054043.1 Yersinia mollaretii ATCC 43969
229 4180329 4180559 - NZ_CP054043.1 Yersinia mollaretii ATCC 43969
230 551914 552189 - NZ_CP043727.1 Yersinia canariae
231 3936162 3936434 + NZ_CP048796.1 Providencia vermicola
232 3385185 3385460 - NZ_CP009787.1 Yersinia rohdei
233 3957182 3957454 + NZ_LS483422.1 Providencia heimbachae
234 4186910 4187185 + NZ_CP011118.1 Yersinia enterocolitica
235 1283216 1283500 + NZ_CP023706.1 Edwardsiella tarda
236 3311762 3312046 + NZ_CP016043.1 Edwardsiella hoshinae
237 782506 782745 - NZ_LR134531.1 Pragia fontium
238 499956 500213 - NZ_CP034752.1 Jinshanibacter zhutongyuii
239 2144920 2145198 + NZ_CP009056.1 Frischella perrara
240 113441 113695 + NC_021883.1 Mannheimia haemolytica USMARC_2286
241 334411 334662 - NZ_LR134327.1 Aggregatibacter aphrophilus ATCC 33389
242 14779 15030 - NZ_LR134327.1 Aggregatibacter aphrophilus ATCC 33389
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_004337.2
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01016.21 0.97 143 1870.5 opposite-strand Ribosomal L27 protein
2 PF00829.23 0.89 131 1583.5 opposite-strand Ribosomal prokaryotic L21 protein
3 PF00348.19 0.97 144 311 same-strand Polyprenyl synthetase
++ More..