Result : P0ACG7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein HokD |
| NCBI Accession ID | |
| Organism | Escherichia coli O157:H7 |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE |
| Source of smORF | Swiss-Prot |
| Function | Toxic component of a type I toxin-antitoxin (TA) system (By similarity). When overexpressed kills cells within minutes; causes collapse of the transmembrane potential and arrest of respiration (By similarity). Its toxic effect is probably neutralized by an antisense antitoxin Sok RNA (By similarity). {ECO:0000250|UniProtKB:P0ACG4}. |
| Pubmed ID | 11206551 11258796 |
| Domain | CDD:421511 |
| Functional Category | Toxin_type_1 |
| Uniprot ID | P0ACG7 |
| ORF Length (Amino Acid) | 51 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1397853 | 1398008 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 2063981 | 2064136 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 1581472 | 1581627 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 905930 | 906085 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 15401 | 15553 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 6 | 2332129 | 2332284 | - | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 2286168 | 2286323 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 8 | 3599125 | 3599277 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 9 | 2700908 | 2701063 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 10 | 1174689 | 1174844 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 11 | 1551312 | 1551467 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 12 | 2243637 | 2243792 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 13 | 1769450 | 1769605 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 14 | 2194047 | 2194202 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 15 | 1305419 | 1305574 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 16 | 15419 | 15571 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 17 | 1334572 | 1334727 | + | NZ_AP014857.1 | Escherichia albertii |
| 18 | 15566 | 15718 | - | NZ_AP014857.1 | Escherichia albertii |
| 19 | 1645119 | 1645274 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 20 | 16751 | 16903 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 21 | 3546880 | 3547032 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 22 | 4220759 | 4220911 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 23 | 4223173 | 4223325 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 24 | 4220130 | 4220279 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 25 | 4219503 | 4219652 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 26 | 4221391 | 4221540 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 27 | 4218771 | 4218920 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 28 | 3517189 | 3517344 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 29 | 3416258 | 3416407 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 30 | 4056013 | 4056168 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 31 | 4345813 | 4345938 | - | NZ_CP011254.1 | Serratia fonticola |
| 32 | 4346409 | 4346540 | - | NZ_CP011254.1 | Serratia fonticola |
| 33 | 625889 | 626044 | - | NZ_CP011254.1 | Serratia fonticola |
| 34 | 5107893 | 5108042 | + | NZ_CP011254.1 | Serratia fonticola |
| 35 | 4354589 | 4354744 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 36 | 4360345 | 4360500 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 37 | 759544 | 759699 | + | NZ_CP071320.1 | Serratia ureilytica |
| 38 | 765311 | 765466 | + | NZ_CP071320.1 | Serratia ureilytica |
| 39 | 3637018 | 3637173 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 40 | 3646118 | 3646273 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 41 | 4341673 | 4341828 | - | NZ_LT906479.1 | Serratia ficaria |
| 42 | 4411265 | 4411420 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 43 | 970324 | 970476 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 44 | 512505 | 512660 | - | NZ_CP009756.1 | Enterobacter cloacae |
++ More..