ProsmORF-pred
Result : P0AC92
Protein Information
Information Type Description
Protein name Protein GnsA
NCBI Accession ID U00096.3
Organism Escherichia coli (strain K12)
Left 1052067
Right 1052240
Strand +
Nucleotide Sequence GTGAATATTGAAGAGTTAAAAAAACAAGCCGAAACGGAAATCGCCGACTTTATCGCGCAAAAAATCGCCGAGCTGAACAAGAATACAGGGAAAGAAGTCTCTGAAATTCGCTTCACCGCACGAGAAAAAATGACCGGGCTTGAAAGTTATGATGTCAAAATCAAAATAATGTGA
Sequence MNIEELKKQAETEIADFIAQKIAELNKNTGKEVSEIRFTAREKMTGLESYDVKIKIM
Source of smORF Swiss-Prot
Function Overexpression increases levels of unsaturated fatty acids and suppresses both the temperature-sensitive fabA6 mutation and cold-sensitive secG null mutation. {ECO:0000269|Pubmed:11544213}.
Pubmed ID 8808925 8905232 9278503 16738553 11544213
Domain CDD:285401
Functional Category Others
Uniprot ID P0AC92
ORF Length (Amino Acid) 57
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 15
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1052067 1052240 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
2 1637609 1637782 - NC_000913.3 Escherichia coli str. K-12 substr. MG1655
3 1062977 1063150 + NZ_AP014857.1 Escherichia albertii
4 1039702 1039875 + NC_004337.2 Shigella flexneri 2a str. 301
5 1709825 1709998 + NZ_LR134340.1 Escherichia marmotae
6 605422 605595 - NZ_CP033744.1 Citrobacter freundii
7 3511054 3511227 - NZ_CP045205.1 Citrobacter telavivensis
8 3997589 3997762 + NZ_CP057657.1 Escherichia fergusonii
9 351156 351329 + NZ_CP038469.1 Citrobacter tructae
10 3675402 3675575 + NZ_CP042941.1 Atlantibacter hermannii
11 1909560 1909733 - NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
12 2970487 2970660 - NZ_CP046672.1 Raoultella ornithinolytica
13 4307641 4307814 + NZ_CP026047.1 Raoultella planticola
14 4420324 4420497 - NZ_CP053416.1 Salmonella bongori
15 4122356 4122529 - NZ_CP016337.1 Kosakonia sacchari
16 1060466 1060639 - NZ_CP035129.1 Kosakonia cowanii
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_000913.3
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00313.24 0.67 10 622.5 same-strand 'Cold-shock' DNA-binding domain
++ More..