Protein Information |
Information Type | Description |
---|---|
Protein name | Protein GnsA |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 1052067 |
Right | 1052240 |
Strand | + |
Nucleotide Sequence | GTGAATATTGAAGAGTTAAAAAAACAAGCCGAAACGGAAATCGCCGACTTTATCGCGCAAAAAATCGCCGAGCTGAACAAGAATACAGGGAAAGAAGTCTCTGAAATTCGCTTCACCGCACGAGAAAAAATGACCGGGCTTGAAAGTTATGATGTCAAAATCAAAATAATGTGA |
Sequence | MNIEELKKQAETEIADFIAQKIAELNKNTGKEVSEIRFTAREKMTGLESYDVKIKIM |
Source of smORF | Swiss-Prot |
Function | Overexpression increases levels of unsaturated fatty acids and suppresses both the temperature-sensitive fabA6 mutation and cold-sensitive secG null mutation. {ECO:0000269|Pubmed:11544213}. |
Pubmed ID | 8808925 8905232 9278503 16738553 11544213 |
Domain | CDD:285401 |
Functional Category | Others |
Uniprot ID | P0AC92 |
ORF Length (Amino Acid) | 57 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1052067 | 1052240 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 1637609 | 1637782 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 1062977 | 1063150 | + | NZ_AP014857.1 | Escherichia albertii |
4 | 1039702 | 1039875 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
5 | 1709825 | 1709998 | + | NZ_LR134340.1 | Escherichia marmotae |
6 | 605422 | 605595 | - | NZ_CP033744.1 | Citrobacter freundii |
7 | 3511054 | 3511227 | - | NZ_CP045205.1 | Citrobacter telavivensis |
8 | 3997589 | 3997762 | + | NZ_CP057657.1 | Escherichia fergusonii |
9 | 351156 | 351329 | + | NZ_CP038469.1 | Citrobacter tructae |
10 | 3675402 | 3675575 | + | NZ_CP042941.1 | Atlantibacter hermannii |
11 | 1909560 | 1909733 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
12 | 2970487 | 2970660 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
13 | 4307641 | 4307814 | + | NZ_CP026047.1 | Raoultella planticola |
14 | 4420324 | 4420497 | - | NZ_CP053416.1 | Salmonella bongori |
15 | 4122356 | 4122529 | - | NZ_CP016337.1 | Kosakonia sacchari |
16 | 1060466 | 1060639 | - | NZ_CP035129.1 | Kosakonia cowanii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00313.24 | 0.67 | 10 | 622.5 | same-strand | 'Cold-shock' DNA-binding domain |