| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein GnsA |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1052067 |
| Right | 1052240 |
| Strand | + |
| Nucleotide Sequence | GTGAATATTGAAGAGTTAAAAAAACAAGCCGAAACGGAAATCGCCGACTTTATCGCGCAAAAAATCGCCGAGCTGAACAAGAATACAGGGAAAGAAGTCTCTGAAATTCGCTTCACCGCACGAGAAAAAATGACCGGGCTTGAAAGTTATGATGTCAAAATCAAAATAATGTGA |
| Sequence | MNIEELKKQAETEIADFIAQKIAELNKNTGKEVSEIRFTAREKMTGLESYDVKIKIM |
| Source of smORF | Swiss-Prot |
| Function | Overexpression increases levels of unsaturated fatty acids and suppresses both the temperature-sensitive fabA6 mutation and cold-sensitive secG null mutation. {ECO:0000269|Pubmed:11544213}. |
| Pubmed ID | 8808925 8905232 9278503 16738553 11544213 |
| Domain | CDD:285401 |
| Functional Category | Others |
| Uniprot ID | P0AC92 |
| ORF Length (Amino Acid) | 57 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1052067 | 1052240 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1637609 | 1637782 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1062977 | 1063150 | + | NZ_AP014857.1 | Escherichia albertii |
| 4 | 1039702 | 1039875 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 1709825 | 1709998 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 605422 | 605595 | - | NZ_CP033744.1 | Citrobacter freundii |
| 7 | 3511054 | 3511227 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 8 | 3997589 | 3997762 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 9 | 351156 | 351329 | + | NZ_CP038469.1 | Citrobacter tructae |
| 10 | 3675402 | 3675575 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 11 | 1909560 | 1909733 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 12 | 2970487 | 2970660 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 13 | 4307641 | 4307814 | + | NZ_CP026047.1 | Raoultella planticola |
| 14 | 4420324 | 4420497 | - | NZ_CP053416.1 | Salmonella bongori |
| 15 | 4122356 | 4122529 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 16 | 1060466 | 1060639 | - | NZ_CP035129.1 | Kosakonia cowanii |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00313.24 | 0.67 | 10 | 622.5 | same-strand | 'Cold-shock' DNA-binding domain |