Result : P0AB63
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein YciN |
| NCBI Accession ID | AE005174.2 |
| Organism | Escherichia coli O157:H7 |
| Left | 2255801 |
| Right | 2256052 |
| Strand | + |
| Nucleotide Sequence | ATGAACAAAGAGACACAACCCATCGACCGCGAAACGCTGTTGAAAGAGGCCAACAAAATCATTCGTGAGCATGAGGATACGCTCGCAGGGATTGAAGCCACCGGCGTCACACAGCGTAATGGCGTGCTGGTATTTACCGGCGACTACTTTTTAGATGAACAAGGATTGCCAACAGCCAAAAGCACCGCGGTGTTTAATATGTTCAAACACCTGGCCCATGTGCTTTCAGAAAAATATCATCTGGTTGATTAA |
| Sequence | MNKETQPIDRETLLKEANKIIREHEDTLAGIEATGVTQRNGVLVFTGDYFLDEQGLPTAKSTAVFNMFKHLAHVLSEKYHLVD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl26494. Profile Description: Protein of unknown function (DUF2498). hypothetical protein; Provisional |
| Pubmed ID | 11206551 11258796 |
| Domain | CDD:421324 |
| Functional Category | Others |
| Uniprot ID | P0AB63 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 179
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2363163 | 2363414 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 2407815 | 2408066 | + | NZ_LR134340.1 | Escherichia marmotae |
| 3 | 1324701 | 1324952 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 1330417 | 1330668 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 5 | 1380018 | 1380269 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 1831261 | 1831512 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 7 | 1842230 | 1842481 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 8 | 717842 | 718093 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 9 | 3996892 | 3997143 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 10 | 2954708 | 2954959 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 11 | 1812786 | 1813037 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 12 | 4323987 | 4324238 | + | NZ_CP053416.1 | Salmonella bongori |
| 13 | 1315567 | 1315818 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 14 | 1150185 | 1150436 | + | NZ_CP038469.1 | Citrobacter tructae |
| 15 | 4686997 | 4687248 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 16 | 382695 | 382946 | + | NZ_CP033744.1 | Citrobacter freundii |
| 17 | 2042917 | 2043168 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 18 | 2588959 | 2589210 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 19 | 2563500 | 2563751 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 20 | 1405311 | 1405562 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 21 | 2595771 | 2596022 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 22 | 2552034 | 2552285 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 23 | 4672637 | 4672888 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 24 | 2646010 | 2646261 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 25 | 2810349 | 2810600 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 26 | 472401 | 472652 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 27 | 2557121 | 2557372 | + | NC_015968.1 | Enterobacter soli |
| 28 | 853268 | 853519 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 29 | 1783804 | 1784055 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 30 | 3327526 | 3327777 | + | NZ_CP050508.1 | Raoultella terrigena |
| 31 | 516302 | 516553 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 32 | 2226923 | 2227174 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 33 | 2093981 | 2094232 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 34 | 3042509 | 3042760 | + | NZ_CP041247.1 | Raoultella electrica |
| 35 | 4001993 | 4002244 | - | NZ_CP026047.1 | Raoultella planticola |
| 36 | 3221950 | 3222201 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 37 | 467062 | 467313 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 38 | 2602868 | 2603119 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 39 | 3515629 | 3515880 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 40 | 2509603 | 2509854 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 41 | 2679359 | 2679610 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 42 | 2595662 | 2595913 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 43 | 2039783 | 2040034 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 44 | 2976588 | 2976839 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 45 | 2154329 | 2154580 | - | NZ_CP023525.1 | Cedecea neteri |
| 46 | 1923486 | 1923737 | + | NZ_LR134201.1 | Cedecea lapagei |
| 47 | 3373020 | 3373271 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 48 | 2987372 | 2987623 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 49 | 2221204 | 2221455 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 50 | 3173694 | 3173945 | + | NZ_CP054254.1 | Klebsiella variicola |
| 51 | 3262502 | 3262753 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 52 | 2211004 | 2211255 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 53 | 4094387 | 4094638 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 54 | 1828471 | 1828722 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 55 | 1686798 | 1687049 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 56 | 2157906 | 2158157 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 57 | 1057399 | 1057650 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 58 | 2394034 | 2394285 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 59 | 1627312 | 1627563 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 60 | 2395772 | 2396023 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 61 | 2327747 | 2327998 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 62 | 2273730 | 2273981 | - | NZ_CP071320.1 | Serratia ureilytica |
| 63 | 4144028 | 4144279 | + | NZ_CP065640.1 | Serratia rubidaea |
| 64 | 4146783 | 4147034 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 65 | 2123241 | 2123492 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 66 | 1737962 | 1738210 | - | NZ_LS483470.1 | Leminorella richardii |
| 67 | 2824775 | 2825026 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 68 | 1189391 | 1189642 | + | NZ_CP016176.1 | Xenorhabdus hominickii |
| 69 | 2227151 | 2227402 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 70 | 2430071 | 2430340 | - | NZ_CP065044.1 | Pectobacterium aroidearum |
| 71 | 1414054 | 1414302 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 72 | 2325715 | 2325972 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 73 | 2868542 | 2868793 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 74 | 3520133 | 3520384 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 75 | 3241001 | 3241249 | - | NZ_CP026364.1 | Proteus hauseri |
| 76 | 2486975 | 2487244 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 77 | 2431426 | 2431695 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 78 | 2524615 | 2524884 | + | NZ_CP034938.1 | Pectobacterium odoriferum |
| 79 | 1169181 | 1169450 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 80 | 2453215 | 2453466 | + | NZ_CP050150.1 | Hafnia alvei |
| 81 | 2150881 | 2151132 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 82 | 3949842 | 3950111 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
| 83 | 4105358 | 4105609 | - | NZ_CP007230.1 | Yersinia similis |
| 84 | 1854828 | 1855043 | + | NZ_CP065534.1 | Lonsdalea populi |
| 85 | 4987997 | 4988248 | + | NZ_CP011254.1 | Serratia fonticola |
| 86 | 1696066 | 1696317 | - | NZ_LR134531.1 | Pragia fontium |
| 87 | 3572698 | 3572949 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 88 | 1781096 | 1781347 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 89 | 2108358 | 2108609 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 90 | 2860444 | 2860701 | + | NZ_LT906479.1 | Serratia ficaria |
| 91 | 526610 | 526861 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 92 | 2105445 | 2105696 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 93 | 1627203 | 1627454 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 94 | 2369441 | 2369656 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 95 | 4142846 | 4143115 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 96 | 2856633 | 2856884 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 97 | 2398164 | 2398415 | + | NZ_CP043727.1 | Yersinia canariae |
| 98 | 2193603 | 2193872 | + | NZ_CP042220.2 | Dickeya poaceiphila |
| 99 | 353940 | 354191 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 100 | 2905680 | 2905931 | + | NZ_LR134494.1 | Serratia quinivorans |
| 101 | 2360859 | 2361128 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 102 | 1931642 | 1931893 | + | NZ_CP032487.1 | Yersinia hibernica |
| 103 | 1617390 | 1617641 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 104 | 2265556 | 2265807 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 105 | 2309122 | 2309379 | - | NZ_CP025799.1 | Dickeya zeae |
| 106 | 2188565 | 2188816 | - | NZ_CP046293.1 | Yersinia intermedia |
| 107 | 3087463 | 3087678 | + | NZ_CP023009.1 | Lonsdalea britannica |
| 108 | 565910 | 566161 | - | NZ_CP009787.1 | Yersinia rohdei |
| 109 | 156584 | 156835 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 110 | 1664666 | 1664917 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 111 | 5510563 | 5510814 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 112 | 2259058 | 2259318 | + | NZ_LT615367.1 | Dickeya aquatica |
| 113 | 395472 | 395741 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 114 | 1720886 | 1721134 | - | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 115 | 1599463 | 1599732 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 116 | 2490619 | 2490888 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 117 | 1648617 | 1648868 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 118 | 914335 | 914586 | - | NZ_CP067057.1 | Rahnella aceris |
| 119 | 4520972 | 4521181 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 120 | 3416945 | 3417196 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 121 | 2292966 | 2293181 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 122 | 2329030 | 2329242 | - | NZ_CP031560.1 | Dickeya dianthicola |
| 123 | 2334443 | 2334694 | + | NZ_CP061511.1 | Mixta calida |
| 124 | 3548047 | 3548298 | - | NZ_CP019706.1 | Pantoea alhagi |
| 125 | 2436245 | 2436496 | + | NZ_CP026377.1 | Mixta gaviniae |
| 126 | 1926368 | 1926616 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 127 | 1528473 | 1528724 | + | NZ_CP028271.1 | Mixta intestinalis |
| 128 | 598676 | 598924 | + | NZ_CP049115.1 | Pantoea stewartii |
| 129 | 2516666 | 2516914 | + | NZ_CP040449.1 | Aeromonas simiae |
| 130 | 1908529 | 1908777 | - | NZ_CP038853.1 | Pantoea vagans |
| 131 | 2148113 | 2148361 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 132 | 1231817 | 1232020 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 133 | 1930575 | 1930844 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 134 | 2209719 | 2209967 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 135 | 3039126 | 3039386 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 136 | 2160371 | 2160631 | - | NZ_LS483422.1 | Providencia heimbachae |
| 137 | 2193179 | 2193445 | + | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 138 | 2330227 | 2330439 | + | NZ_CP046268.1 | Vibrio spartinae |
| 139 | 1424483 | 1424731 | + | NZ_CP035688.1 | Vibrio metoecus |
| 140 | 194901 | 195152 | - | NZ_CP046793.1 | Vibrio metschnikovii |
| 141 | 2083494 | 2083739 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 142 | 2590067 | 2590276 | + | NC_013456.1 | Vibrio antiquarius |
| 143 | 2000020 | 2000286 | + | NZ_CP018312.1 | Vibrio rotiferianus |
| 144 | 1319154 | 1319420 | - | NZ_CP009467.1 | Vibrio harveyi |
| 145 | 1135289 | 1135498 | + | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 146 | 2888736 | 2888993 | + | NZ_CP029736.1 | Providencia rettgeri |
| 147 | 1630340 | 1630597 | + | NZ_CP031123.2 | Providencia huaxiensis |
| 148 | 1820272 | 1820520 | + | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 149 | 46833 | 47048 | + | NZ_CP014056.2 | Grimontia hollisae |
| 150 | 936887 | 937135 | - | NZ_CP014035.2 | Vibrio fluvialis |
| 151 | 1714905 | 1715162 | + | NZ_AP018685.1 | Vibrio rumoiensis |
| 152 | 1057238 | 1057447 | - | NZ_CP032093.1 | Vibrio alfacsensis |
| 153 | 1126592 | 1126801 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 154 | 2418214 | 2418462 | + | NZ_CP040990.1 | Vibrio furnissii |
| 155 | 2680581 | 2680787 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 156 | 1265754 | 1265993 | - | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 157 | 742413 | 742622 | + | NZ_CP019959.1 | Vibrio owensii |
| 158 | 1030677 | 1030943 | - | NZ_CP030788.1 | Vibrio campbellii |
| 159 | 3041248 | 3041457 | + | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 160 | 2280479 | 2280727 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 161 | 1725144 | 1725392 | + | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 162 | 1997441 | 1997650 | + | NZ_AP019651.1 | Vibrio taketomensis |
| 163 | 19141 | 19389 | - | NZ_CP047476.1 | Vibrio astriarenae |
| 164 | 687365 | 687613 | - | NZ_AP019657.1 | Vibrio ponticus |
| 165 | 1735049 | 1735294 | + | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 166 | 2309417 | 2309626 | + | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 167 | 1104940 | 1105146 | - | NZ_CP071325.1 | Photobacterium ganghwense |
| 168 | 4407438 | 4407686 | - | NZ_CP044060.1 | Aeromonas veronii |
| 169 | 1347354 | 1347563 | - | NZ_AP014635.1 | Vibrio tritonius |
| 170 | 1340205 | 1340453 | - | NZ_CP050851.1 | Aeromonas hydrophila |
| 171 | 76837 | 77085 | - | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 172 | 812496 | 812744 | - | NZ_CP016414.1 | Vibrio scophthalmi |
| 173 | 1000282 | 1000539 | - | NZ_AP018689.1 | Vibrio aphrogenes |
| 174 | 1133265 | 1133510 | - | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 175 | 1659553 | 1659771 | + | NZ_CP022741.1 | Vibrio qinghaiensis |
| 176 | 3478079 | 3478327 | + | NZ_AP022188.1 | Aeromonas media |
| 177 | 3373010 | 3373258 | + | NZ_LR134376.1 | Aeromonas encheleia |
| 178 | 1136479 | 1136724 | - | NC_011753.2 | Vibrio atlanticus |
| 179 | 297937 | 298182 | + | NZ_CP065150.1 | Vibrio kanaloae |
| 180 | 1220732 | 1220944 | - | NZ_CP033078.1 | Vibrio zhugei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061527.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03466.22 | 0.77 | 138 | 3295 | opposite-strand | LysR substrate binding domain |
| 2 | PF00126.29 | 0.77 | 138 | 3295 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 3 | PF01131.22 | 0.96 | 172 | 402 | opposite-strand | DNA topoisomerase |
| 4 | PF08272.13 | 0.96 | 172 | 402 | opposite-strand | Topoisomerase I zinc-ribbon-like |
| 5 | PF01751.24 | 0.95 | 170 | 402 | opposite-strand | Toprim domain |
| 6 | PF01396.21 | 0.96 | 172 | 402 | opposite-strand | Topoisomerase DNA binding C4 zinc finger |
| 7 | PF08496.12 | 0.8 | 144 | 59 | opposite-strand | Peptidase family S49 N-terminal |
| 8 | PF01343.20 | 0.8 | 144 | 59 | opposite-strand | Peptidase family S49 |
| 9 | PF00106.27 | 0.8 | 144 | 1360 | same-strand | short chain dehydrogenase |
| 10 | PF13561.8 | 0.65 | 116 | 1345 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 11 | PF08659.12 | 0.8 | 144 | 1360 | same-strand | KR domain |
| 12 | PF02572.17 | 0.72 | 128 | 2116 | same-strand | ATP:corrinoid adenosyltransferase BtuR/CobO/CobP |
| 13 | PF00849.24 | 0.61 | 110 | 2822 | opposite-strand | RNA pseudouridylate synthase |
| 14 | PF01479.27 | 0.64 | 114 | 2814 | opposite-strand | S4 domain |
++ More..