Result : P0AAY4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YbjH |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 884946 |
| Right | 885230 |
| Strand | - |
| Nucleotide Sequence | ATGATTATGAAAAATTGTCTACTGTTGGGCGCGCTTTTAATGGGCTTTACTGGTGTGGCGATGGCGCAAAGTGTCACCGTCGATGTGCCGAGTGGATACAAAGTGGTTGTGGTTCCTGATTCAGTCAGCGTTCCACAAGCGGTCAGCGTCGCGACTGTGCCGCAAACCGTCTATGTGGCTCCTGCGCCAGCTCCGGCTTACCGCCCGCATCCTTATGTTCGCCATCTTGCCAGCGTAGGTGAAGGGATGGTTATCGAACACCAGATTGACGACCATCACCATTAA |
| Sequence | MIMKNCLLLGALLMGFTGVAMAQSVTVDVPSGYKVVVVPDSVSVPQAVSVATVPQTVYVAPAPAPAYRPHPYVRHLASVGEGMVIEHQIDDHHH |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 8905232 9278503 16738553 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P0AAY4 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 830363 | 830647 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 884946 | 885230 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1010234 | 1010518 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 875545 | 875829 | - | NZ_AP014857.1 | Escherichia albertii |
| 5 | 1534289 | 1534573 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 4518037 | 4518282 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 1837702 | 1837956 | + | NZ_CP038469.1 | Citrobacter tructae |
| 8 | 699083 | 699334 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 9 | 4409838 | 4410089 | - | NZ_CP033744.1 | Citrobacter freundii |
| 10 | 3964446 | 3964718 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 11 | 3334468 | 3334740 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 12 | 4284193 | 4284423 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 13 | 3937214 | 3937486 | - | NC_015968.1 | Enterobacter soli |
| 14 | 2832738 | 2832995 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 15 | 4067044 | 4067301 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00455.24 | 0.64 | 9 | 2212.5 | same-strand | DeoR C terminal sensor domain |
| 2 | PF08220.14 | 0.64 | 9 | 2212.5 | same-strand | DeoR-like helix-turn-helix domain |
| 3 | PF17940.3 | 0.71 | 10 | 2193 | opposite-strand | Tetracyclin repressor-like, C-terminal domain |
| 4 | PF00440.25 | 0.79 | 11 | 2193.0 | opposite-strand | Bacterial regulatory proteins, tetR family |
| 5 | PF13417.8 | 0.64 | 9 | 4465.5 | same-strand | Glutathione S-transferase, N-terminal domain |
| 6 | PF13409.8 | 0.64 | 9 | 4465.5 | same-strand | Glutathione S-transferase, N-terminal domain |
| 7 | PF13410.8 | 0.64 | 9 | 4465.5 | same-strand | Glutathione S-transferase, C-terminal domain |
++ More..