Result : P0AAX6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein McbA (MqsR-controlled colanic acid and biofilm protein A) |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 841796 |
| Right | 842056 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAAGTGCCTCACACTACTGATTGCCACCGTCCTGAGCGGAATCTCTCTCACGGCTTATGCCGCGCAACCGATGAGTAACCTGGACAGCGGTCAGCTACGGCCCGCCGGTACCGTTTCGGCAACTGGCGCATCAAACCTAAGCGATCTGGAGGATAAACTGGCAGAAAAAGCGCGCGAACAAGGCGCGAAAGGTTATGTCATTAATTCCGCAGGCGGAAATGACCAGATGTTCGGTACTGCAACCATCTACAAATAA |
| Sequence | MKKCLTLLIATVLSGISLTAYAAQPMSNLDSGQLRPAGTVSATGASNLSDLEDKLAEKAREQGAKGYVINSAGGNDQMFGTATIYK |
| Source of smORF | Swiss-Prot |
| Function | Affects biofilm formation and mucoidy. {ECO:0000269|Pubmed:18309357}. |
| Pubmed ID | 8905232 9278503 16738553 18309357 |
| Domain | CDD:416304 |
| Functional Category | Others |
| Uniprot ID | P0AAX6 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 841796 | 842056 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 966248 | 966508 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 1303226 | 1303486 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 4 | 2873684 | 2873944 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 785859 | 786119 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 6 | 1486212 | 1486472 | - | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 836484 | 836744 | - | NZ_AP014857.1 | Escherichia albertii |
| 8 | 2146367 | 2146627 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 9 | 4006797 | 4007057 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 10 | 4368557 | 4368817 | - | NZ_CP033744.1 | Citrobacter freundii |
| 11 | 743437 | 743697 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 12 | 82771 | 83031 | - | NZ_CP038469.1 | Citrobacter tructae |
| 13 | 3066587 | 3066847 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 14 | 1394395 | 1394658 | - | NC_015968.1 | Enterobacter soli |
| 15 | 3960749 | 3961015 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 16 | 338221 | 338478 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 17 | 3026535 | 3026795 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 18 | 3035477 | 3035737 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 19 | 1559105 | 1559368 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 20 | 1458848 | 1459114 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 21 | 1440241 | 1440507 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 22 | 1427699 | 1427965 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 23 | 2077912 | 2078178 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 24 | 1389163 | 1389429 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 25 | 617809 | 618075 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 26 | 2696168 | 2696431 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 27 | 3365875 | 3366135 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 28 | 3071040 | 3071303 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 29 | 1632000 | 1632266 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 30 | 3153232 | 3153489 | + | NZ_LR134201.1 | Cedecea lapagei |
| 31 | 1122308 | 1122574 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 32 | 3372436 | 3372693 | + | NZ_CP023525.1 | Cedecea neteri |
| 33 | 3438458 | 3438724 | - | NZ_CP026047.1 | Raoultella planticola |
| 34 | 3434095 | 3434355 | - | NZ_CP026047.1 | Raoultella planticola |
| 35 | 3792674 | 3792940 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 36 | 3797042 | 3797302 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 37 | 3647982 | 3648242 | + | NZ_CP041247.1 | Raoultella electrica |
| 38 | 72973 | 73230 | - | NZ_LT615367.1 | Dickeya aquatica |
| 39 | 890465 | 890725 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 40 | 3934948 | 3935211 | + | NZ_CP050508.1 | Raoultella terrigena |
| 41 | 2108662 | 2108922 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 42 | 2801336 | 2801596 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 43 | 2285835 | 2286095 | - | NZ_CP071320.1 | Serratia ureilytica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009792.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07338.15 | 0.8 | 32 | 747 | same-strand | Protein of unknown function (DUF1471) |
| 2 | PF01258.19 | 0.62 | 25 | 286.0 | same-strand | Prokaryotic dksA/traR C4-type zinc finger |
| 3 | PF05971.14 | 0.88 | 35 | 276.0 | opposite-strand | RNA methyltransferase |
| 4 | PF00924.20 | 0.78 | 31 | 1203.5 | same-strand | Mechanosensitive ion channel |
| 5 | PF00005.29 | 0.82 | 33 | 3551.5 | same-strand | ABC transporter |
| 6 | PF00528.24 | 0.82 | 33 | 4270.5 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 7 | PF00497.22 | 0.6 | 24 | 5014 | same-strand | Bacterial extracellular solute-binding proteins, family 3 |
| 8 | PF02885.19 | 0.62 | 25 | 1055 | opposite-strand | Glycosyl transferase family, helical bundle domain |
++ More..