ProsmORF-pred
Result : A4SML6
Protein Information
Information Type Description
Protein name Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase)
NCBI Accession ID CP000644.1
Organism Aeromonas salmonicida (strain A449)
Left 2201228
Right 2201500
Strand -
Nucleotide Sequence ATGGGAGAGCAATCGTTTGTCGTGCACGTCTGGGGTCAGGTGCAAGGGGTGGGATTTCGCTACTTTACCCGTGAGCGGGCGTTGCAACTGGGACTGCGTGGCTACGCCTACAACCTGGCTGATGGCTCGGTGGAGATCCTGATCTGTGGTCCCGAGCAGGGGGTGCAGATGATGCTGGGCTGGCTGGAGCACGGGCCGCGCACCGCCGAGGTGACTAGGATGGAGTATGAAGAGGCACCGCCACCACAGAAAGGGGGATTTCACACCAATTGA
Sequence MGEQSFVVHVWGQVQGVGFRYFTRERALQLGLRGYAYNLADGSVEILICGPEQGVQMMLGWLEHGPRTAEVTRMEYEEAPPPQKGGFHTN
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional
Pubmed ID 18801193
Domain CDD:412440
Functional Category Others
Uniprot ID A4SML6
ORF Length (Amino Acid) 90
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 46
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1292575 1292847 - NZ_CP051883.1 Aeromonas salmonicida
2 2438718 2438990 - NZ_CP050851.1 Aeromonas hydrophila
3 1008112 1008384 + NZ_CP065745.1 Aeromonas allosaccharophila
4 837754 838026 + NZ_CP044060.1 Aeromonas veronii
5 2243053 2243325 + NZ_LR134376.1 Aeromonas encheleia
6 2380139 2380411 + NZ_AP022188.1 Aeromonas media
7 1703827 1704099 + NZ_CP040449.1 Aeromonas simiae
8 155708 155977 + NZ_CP034759.1 Litorilituus sediminis
9 2935499 2935780 + NZ_CP020388.1 Pluralibacter gergoviae
10 3545100 3545324 - NZ_CP035704.1 Pseudolysobacter antarcticus
11 2631414 2631650 - NZ_CP005974.1 Photobacterium gaetbulicola Gung47
12 4075282 4075527 - NZ_CP034752.1 Jinshanibacter zhutongyuii
13 607774 608046 - NZ_LR134327.1 Aggregatibacter aphrophilus ATCC 33389
14 1632580 1632858 + NZ_CP061511.1 Mixta calida
15 3648454 3648687 + NZ_CP026047.1 Raoultella planticola
16 141541 141771 - NC_012691.1 Tolumonas auensis DSM 9187
17 3596288 3596521 - NZ_CP046672.1 Raoultella ornithinolytica
18 2522400 2522681 - NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
19 3426334 3426588 - NZ_CP041247.1 Raoultella electrica
20 3296077 3296355 + NZ_CP065640.1 Serratia rubidaea
21 4219586 4219864 - NZ_CP019706.1 Pantoea alhagi
22 1759016 1759246 + NC_014306.1 Erwinia billingiae Eb661
23 1710380 1710658 + NZ_CP026377.1 Mixta gaviniae
24 2188470 2188700 - NZ_CP011367.1 Thioalkalivibrio versutus
25 3573773 3574006 - NZ_CP054254.1 Klebsiella variicola
26 3326055 3326318 - NZ_CP065838.1 Klebsiella quasipneumoniae
27 3952425 3952688 - NZ_CP060111.1 Klebsiella michiganensis
28 3766649 3766912 - NZ_CP036175.1 Klebsiella huaxiensis
29 1742350 1742631 + NZ_CP012871.1 [Enterobacter] lignolyticus
30 3196365 3196610 + NZ_CP040428.1 Jejubacter calystegiae
31 1884734 1885012 + NZ_LR134494.1 Serratia quinivorans
32 710233 710487 - NZ_CP044231.1 Microbacterium caowuchunii
33 1392201 1392479 + NC_012779.2 Edwardsiella ictaluri 93-146
34 1871770 1872039 + NZ_CP017689.1 Thalassotalea crassostreae
35 2876228 2876509 - NZ_AP023184.1 Buttiauxella agrestis
36 859052 859276 - NZ_CP043476.1 Xanthomonas hyacinthi
37 1113744 1113971 + NZ_CP046914.1 Paraburkholderia acidisoli
38 1328625 1328852 - NZ_CP049135.1 Paraburkholderia tropica
39 4322238 4322480 - NZ_CP027860.1 Ahniella affigens
40 412381 412668 + NZ_CP021255.1 Desulfobulbus oralis
41 2053301 2053546 - NZ_CP071325.1 Photobacterium ganghwense
42 695258 695524 - NZ_AP018686.1 Vibrio rumoiensis
43 752666 752905 - NZ_CP066802.1 Actinomyces weissii
44 562636 562863 + NZ_CP029642.1 Arthrobacter dokdonellae
45 2354876 2355133 - NC_010694.1 Erwinia tasmaniensis Et1/99
46 4660643 4660891 - NZ_CP043311.1 Pseudomonas lalkuanensis
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP051883.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF17785.3 0.7 32 1604.5 opposite-strand PUA-like domain
++ More..