Result : P0AAU9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YbfE |
| NCBI Accession ID | |
| Organism | Shigella flexneri |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MAKEQTDRTTLDLFAHERRPGRPKTNPLSRDEQLRINKRNQLKRDKVRGLKRVELKLNAEAVEALNELAESRNMSRSELIEEMLMQQLAALRSQGIV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22901. Profile Description: Ribbon-helix-helix protein, copG family. ParD is the antitoxin of a bacterial toxin-antitoxin gene pair. The cognate toxin is ParE in, pfam05016. The family contains several related antitoxins from Cyanobacteria, Proteobacteria and Actinobacteria. Antitoxins of this class carry an N-terminal ribbon-helix-helix domain, RHH, that is highly conserved across all type II bacterial antitoxins, which dimerizes with the RHH domain of a second VapB molecule. A hinge section follows the RHH, with an additional pair of flexible alpha helices at the C-terminus. This C-terminus is the toxin-binding region of the dimer, and so is specific to the cognate toxin, whereas the RHH domain has the specific function of lying across the RNA-binding groove of the toxin dimer and inactivating the active-site - a more general function of all type II antitoxins.**The ORF matches to the profile of PRK11675. Profile Description: LexA regulated protein; Provisional |
| Pubmed ID | 12384590 12704152 |
| Domain | CDD:419885,CDD:183272 |
| Functional Category | Others |
| Uniprot ID | P0AAU9 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 218
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3027465 | 3027758 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 1347006 | 1347299 | - | NZ_LR134340.1 | Escherichia marmotae |
| 3 | 1472638 | 1472931 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 4 | 639948 | 640241 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 711605 | 711898 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 6 | 791630 | 791923 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 7 | 693042 | 693335 | - | NZ_AP014857.1 | Escherichia albertii |
| 8 | 2292855 | 2293148 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 9 | 758972 | 759265 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 10 | 3233013 | 3233306 | - | NZ_CP053416.1 | Salmonella bongori |
| 11 | 757812 | 758105 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 12 | 1431029 | 1431322 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 13 | 3670372 | 3670665 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 14 | 1604817 | 1605110 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 15 | 4186826 | 4187119 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 16 | 3708698 | 3708991 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 17 | 4045290 | 4045583 | + | NZ_CP050508.1 | Raoultella terrigena |
| 18 | 3926557 | 3926850 | + | NZ_CP054254.1 | Klebsiella variicola |
| 19 | 2922137 | 2922430 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 20 | 4238437 | 4238724 | - | NZ_CP033744.1 | Citrobacter freundii |
| 21 | 4155809 | 4156102 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 22 | 871651 | 871938 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 23 | 1940321 | 1940608 | + | NZ_CP038469.1 | Citrobacter tructae |
| 24 | 2546146 | 2546439 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 25 | 3263089 | 3263382 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 26 | 4310772 | 4311065 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 27 | 3324212 | 3324505 | - | NZ_CP026047.1 | Raoultella planticola |
| 28 | 3907429 | 3907722 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 29 | 3756402 | 3756695 | + | NZ_CP041247.1 | Raoultella electrica |
| 30 | 3270386 | 3270667 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 31 | 1558577 | 1558861 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 32 | 3779130 | 3779414 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 33 | 1429124 | 1429408 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 34 | 1633581 | 1633862 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 35 | 1426017 | 1426298 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 36 | 3014644 | 3014937 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 37 | 2910434 | 2910715 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 38 | 3184660 | 3184953 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 39 | 4251740 | 4252033 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 40 | 1349820 | 1350107 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 41 | 358432 | 358713 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 42 | 237397 | 237684 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 43 | 1286561 | 1286848 | - | NZ_LR134494.1 | Serratia quinivorans |
| 44 | 2751955 | 2752242 | - | NZ_CP065640.1 | Serratia rubidaea |
| 45 | 3574622 | 3574900 | + | NZ_CP023525.1 | Cedecea neteri |
| 46 | 1284298 | 1284585 | - | NC_015968.1 | Enterobacter soli |
| 47 | 1254525 | 1254806 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 48 | 1452100 | 1452381 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 49 | 1227012 | 1227299 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 50 | 1327332 | 1327619 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 51 | 3310068 | 3310346 | + | NZ_LR134201.1 | Cedecea lapagei |
| 52 | 3776720 | 3777007 | + | NZ_CP071320.1 | Serratia ureilytica |
| 53 | 587656 | 587943 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 54 | 1281953 | 1282240 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 55 | 3410191 | 3410478 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 56 | 2625631 | 2625912 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 57 | 2589605 | 2589892 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 58 | 3196472 | 3196759 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 59 | 3291430 | 3291717 | + | NZ_CP043727.1 | Yersinia canariae |
| 60 | 3310746 | 3311033 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 61 | 2696432 | 2696719 | + | NZ_CP032487.1 | Yersinia hibernica |
| 62 | 3019377 | 3019664 | - | NZ_CP007230.1 | Yersinia similis |
| 63 | 1405980 | 1406267 | - | NZ_CP046293.1 | Yersinia intermedia |
| 64 | 1362499 | 1362786 | - | NZ_LT906479.1 | Serratia ficaria |
| 65 | 3513601 | 3513888 | - | NZ_CP011254.1 | Serratia fonticola |
| 66 | 3344471 | 3344752 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 67 | 4138269 | 4138562 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 68 | 3166061 | 3166342 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 69 | 3564788 | 3565069 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 70 | 1216381 | 1216662 | - | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 71 | 4225206 | 4225493 | - | NZ_CP009787.1 | Yersinia rohdei |
| 72 | 3478425 | 3478712 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 73 | 1355731 | 1356012 | - | NZ_CP025799.1 | Dickeya zeae |
| 74 | 2745024 | 2745308 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 75 | 1490741 | 1491022 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 76 | 3351192 | 3351473 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 77 | 290548 | 290829 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 78 | 169655 | 169936 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 79 | 3386632 | 3386913 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 80 | 1540996 | 1541277 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 81 | 262286 | 262561 | + | NZ_CP019706.1 | Pantoea alhagi |
| 82 | 715446 | 715727 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
| 83 | 1491567 | 1491848 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 84 | 1330138 | 1330413 | - | NZ_CP061511.1 | Mixta calida |
| 85 | 1162853 | 1163149 | - | NZ_CP034035.1 | Brenneria rubrifaciens |
| 86 | 3144607 | 3144900 | + | NZ_CP048796.1 | Providencia vermicola |
| 87 | 2768253 | 2768549 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 88 | 1197151 | 1197423 | - | NZ_LN907827.1 | Erwinia gerundensis |
| 89 | 1127835 | 1128122 | + | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 90 | 1425870 | 1426145 | - | NZ_CP026377.1 | Mixta gaviniae |
| 91 | 1297460 | 1297750 | - | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 92 | 4710380 | 4710670 | + | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 93 | 1227023 | 1227310 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 94 | 2657244 | 2657543 | - | NZ_CP026364.1 | Proteus hauseri |
| 95 | 2870414 | 2870695 | + | NZ_CP042220.2 | Dickeya poaceiphila |
| 96 | 1068421 | 1068729 | - | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 97 | 713856 | 714149 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 98 | 587115 | 587414 | - | NC_010554.1 | Proteus mirabilis HI4320 |
| 99 | 364216 | 364503 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 100 | 1545331 | 1545618 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 101 | 2976093 | 2976368 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 102 | 2926792 | 2927067 | + | NZ_CP038853.1 | Pantoea vagans |
| 103 | 2043331 | 2043621 | + | NZ_CP016176.1 | Xenorhabdus hominickii |
| 104 | 2337028 | 2337318 | + | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 105 | 3135695 | 3135985 | + | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 106 | 3648407 | 3648697 | + | NC_012962.1 | Photorhabdus asymbiotica |
| 107 | 3343979 | 3344260 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 108 | 2157390 | 2157683 | - | NZ_CP029736.1 | Providencia rettgeri |
| 109 | 1133561 | 1133836 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 110 | 3023742 | 3024041 | + | NZ_LS483422.1 | Providencia heimbachae |
| 111 | 3720063 | 3720356 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 112 | 3256988 | 3257272 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 113 | 689693 | 689983 | + | NZ_CP060401.1 | Xenorhabdus nematophila |
| 114 | 4081354 | 4081629 | - | NZ_CP049115.1 | Pantoea stewartii |
| 115 | 2294021 | 2294302 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 116 | 1266393 | 1266668 | - | NZ_CP050150.1 | Hafnia alvei |
| 117 | 668049 | 668327 | + | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 118 | 969656 | 969934 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 119 | 2788319 | 2788597 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 120 | 2664347 | 2664625 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 121 | 1220471 | 1220752 | - | NZ_CP065534.1 | Lonsdalea populi |
| 122 | 2200475 | 2200756 | + | NZ_CP067057.1 | Rahnella aceris |
| 123 | 594390 | 594665 | - | NZ_CP028271.1 | Mixta intestinalis |
| 124 | 1293323 | 1293598 | - | NZ_CP015581.1 | Tatumella citrea |
| 125 | 1178458 | 1178757 | - | NZ_CP040449.1 | Aeromonas simiae |
| 126 | 1283718 | 1283999 | - | NC_012880.1 | Musicola paradisiaca Ech703 |
| 127 | 2340897 | 2341166 | + | NZ_LS483470.1 | Leminorella richardii |
| 128 | 1658801 | 1659097 | - | NZ_CP050851.1 | Aeromonas hydrophila |
| 129 | 2344314 | 2344592 | + | NZ_CP009888.1 | Pseudoalteromonas piratica |
| 130 | 3229802 | 3230098 | + | NZ_AP022188.1 | Aeromonas media |
| 131 | 1963500 | 1963796 | + | NZ_CP051883.1 | Aeromonas salmonicida |
| 132 | 1451584 | 1451880 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 133 | 1945490 | 1945768 | + | NZ_CP027523.1 | Pseudoalteromonas carrageenovora |
| 134 | 1827547 | 1827825 | - | NZ_CP011025.1 | Pseudoalteromonas arctica A 37-1-2 |
| 135 | 3902562 | 3902840 | + | NZ_CP019628.1 | Pseudoalteromonas aliena |
| 136 | 1396652 | 1396924 | - | NZ_CP031560.1 | Dickeya dianthicola |
| 137 | 1417049 | 1417330 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 138 | 1384702 | 1384983 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 139 | 939064 | 939357 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 140 | 3521441 | 3521722 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 141 | 1791315 | 1791593 | + | NZ_CP011041.1 | Pseudoalteromonas tetraodonis |
| 142 | 1737840 | 1738118 | + | NZ_CP011030.1 | Pseudoalteromonas issachenkonii |
| 143 | 2220150 | 2220440 | + | NZ_CP029185.2 | Limnobaculum parvum |
| 144 | 3018714 | 3018995 | + | NZ_LT615367.1 | Dickeya aquatica |
| 145 | 2419937 | 2420227 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 146 | 177254 | 177550 | - | NZ_CP044060.1 | Aeromonas veronii |
| 147 | 438797 | 439093 | - | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 148 | 1706942 | 1707220 | + | NC_007481.1 | Pseudoalteromonas translucida |
| 149 | 1892142 | 1892420 | + | NZ_CP011036.1 | Pseudoalteromonas nigrifaciens |
| 150 | 1469733 | 1470011 | - | NZ_CP011039.1 | Pseudoalteromonas spongiae UST010723-006 |
| 151 | 1876348 | 1876626 | + | NZ_CP033065.1 | Pseudoalteromonas agarivorans |
| 152 | 1738757 | 1739035 | - | NZ_CP023464.1 | Pseudoalteromonas atlantica |
| 153 | 1905319 | 1905597 | + | NZ_CP032090.1 | Pseudoalteromonas donghaensis |
| 154 | 1971083 | 1971361 | + | NZ_CP011028.1 | Pseudoalteromonas espejiana DSM 9414 |
| 155 | 2006539 | 2006817 | + | NZ_CP013187.1 | Pseudoalteromonas phenolica |
| 156 | 1180117 | 1180395 | - | NZ_CP031961.1 | Pseudoalteromonas tunicata |
| 157 | 3339289 | 3339567 | - | NZ_CP072425.1 | Pseudoalteromonas viridis |
| 158 | 1897867 | 1898145 | - | NZ_CP037951.1 | Parashewanella tropica |
| 159 | 1782111 | 1782410 | - | NZ_CP031416.1 | Gallaecimonas mangrovi |
| 160 | 1622756 | 1623037 | - | NC_003910.7 | Colwellia psychrerythraea 34H |
| 161 | 4603301 | 4603573 | - | NZ_CP036200.1 | Shewanella maritima |
| 162 | 2565611 | 2565883 | - | NC_016901.1 | Shewanella baltica OS678 |
| 163 | 2294549 | 2294821 | - | NZ_CP022358.1 | Shewanella bicestrii |
| 164 | 2392965 | 2393237 | + | NZ_CP041036.1 | Shewanella polaris |
| 165 | 1724235 | 1724555 | - | NZ_CP028897.1 | Dongshaea marina |
| 166 | 3354484 | 3354756 | + | NZ_CP037952.1 | Parashewanella spongiae |
| 167 | 410729 | 411013 | + | NZ_CP021377.1 | Oceanisphaera profunda |
| 168 | 2718055 | 2718327 | + | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 169 | 2794486 | 2794758 | + | NZ_CP034015.1 | Shewanella livingstonensis |
| 170 | 2374975 | 2375247 | - | NZ_CP020472.1 | Shewanella japonica |
| 171 | 2262533 | 2262805 | - | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 172 | 825642 | 825914 | + | NZ_CP041783.1 | Shewanella donghaensis |
| 173 | 1114105 | 1114380 | + | NZ_CP034759.1 | Litorilituus sediminis |
| 174 | 1480552 | 1480830 | - | NZ_CP017689.1 | Thalassotalea crassostreae |
| 175 | 859061 | 859333 | - | NZ_CP014782.1 | Shewanella psychrophila |
| 176 | 2340999 | 2341271 | - | NC_014012.1 | Shewanella violacea DSS12 |
| 177 | 1144902 | 1145180 | - | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 178 | 2636855 | 2637172 | + | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 179 | 2225534 | 2225806 | + | NZ_CP022272.1 | Shewanella marisflavi |
| 180 | 2216422 | 2216694 | - | NC_009092.1 | Shewanella loihica PV-4 |
| 181 | 2742989 | 2743261 | + | NC_011566.1 | Shewanella piezotolerans WP3 |
| 182 | 2485340 | 2485609 | - | NZ_CP046378.1 | Shewanella algae |
| 183 | 1584158 | 1584430 | - | NZ_CP020373.1 | Shewanella khirikhana |
| 184 | 1957855 | 1958127 | - | NZ_CP069213.1 | Shewanella litorisediminis |
| 185 | 2082781 | 2083053 | - | NC_008700.1 | Shewanella amazonensis SB2B |
| 186 | 2485363 | 2485635 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 187 | 2354561 | 2354833 | + | NC_007954.1 | Shewanella denitrificans OS217 |
| 188 | 876126 | 876422 | - | NZ_CP051180.1 | Ferrimonas lipolytica |
| 189 | 3216137 | 3216424 | - | NZ_CP020465.1 | Cognaticolwellia beringensis |
| 190 | 2788202 | 2788474 | - | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 191 | 114080 | 114364 | + | NZ_CP028926.1 | Pasteurella multocida |
| 192 | 2834297 | 2834572 | + | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 193 | 470371 | 470655 | - | NZ_LT906448.1 | Pasteurella dagmatis |
| 194 | 716121 | 716393 | - | NZ_CP044399.1 | Moritella marina ATCC 15381 |
| 195 | 637845 | 638123 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 196 | 454325 | 454609 | - | NZ_CP015031.1 | Basfia succiniciproducens |
| 197 | 835736 | 836020 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 198 | 88688 | 88972 | - | NZ_LR134510.1 | Actinobacillus delphinicola |
| 199 | 1128829 | 1129116 | - | NZ_LR134167.1 | Avibacterium volantium |
| 200 | 1518462 | 1518752 | - | NZ_CP016180.1 | Pasteurella skyensis |
| 201 | 2135328 | 2135603 | + | NZ_CP046531.1 | Mannheimia ovis |
| 202 | 422050 | 422334 | - | NZ_CP021376.1 | Oceanisphaera avium |
| 203 | 1095364 | 1095633 | - | NC_008709.1 | Psychromonas ingrahamii 37 |
| 204 | 1518819 | 1519094 | + | NZ_CP016604.1 | Otariodibacter oris |
| 205 | 1439874 | 1440158 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 206 | 123816 | 124109 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 207 | 149040 | 149333 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 208 | 384917 | 385189 | - | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 209 | 1862329 | 1862613 | + | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 210 | 2148483 | 2148758 | + | NZ_CP061280.1 | Mannheimia bovis |
| 211 | 2145010 | 2145285 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 212 | 1690086 | 1690361 | + | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 213 | 2224697 | 2224990 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 214 | 2162748 | 2163023 | + | NZ_CP055305.1 | Mannheimia pernigra |
| 215 | 992262 | 992534 | - | NZ_CP015029.1 | Frederiksenia canicola |
| 216 | 1658181 | 1658465 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 217 | 988930 | 989226 | + | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 218 | 2225922 | 2226215 | + | NC_011852.1 | Glaesserella parasuis SH0165 |
| 219 | 2471725 | 2472009 | + | NZ_CP012621.1 | Zobellella denitrificans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061527.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02878.18 | 0.8 | 174 | 1851 | opposite-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I |
| 2 | PF02880.18 | 0.8 | 175 | 1855.5 | opposite-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III |
| 3 | PF02879.18 | 0.8 | 174 | 1855 | opposite-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II |
| 4 | PF03925.15 | 0.86 | 188 | 1246 | opposite-strand | SeqA protein C-terminal domain |
| 5 | PF17206.5 | 0.87 | 189 | 1243.5 | opposite-strand | SeqA protein N-terminal domain |
| 6 | PF12697.9 | 0.88 | 191 | 260 | same-strand | Alpha/beta hydrolase family |
| 7 | PF00258.27 | 1.0 | 218 | 148 | same-strand | Flavodoxin |
| 8 | PF01475.21 | 0.85 | 185 | 978.0 | same-strand | Ferric uptake regulator family |
++ More..