Result : P0AAQ1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YaiZ |
| NCBI Accession ID | |
| Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIRRRDEETENAQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10953. Profile Description: Protein of unknown function (DUF2754). This family of proteins with unknown function appear to be restricted to Enterobacteriaceae. |
| Pubmed ID | 12471157 |
| Domain | CDD:402504 |
| Functional Category | Others |
| Uniprot ID | P0AAQ1 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 54
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3260396 | 3260608 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 399593 | 399805 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 459373 | 459585 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 256552 | 256764 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 1041232 | 1041444 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 412572 | 412784 | + | NZ_AP014857.1 | Escherichia albertii |
| 7 | 2263366 | 2263584 | - | NZ_CP038469.1 | Citrobacter tructae |
| 8 | 1228562 | 1228780 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 9 | 3890248 | 3890466 | + | NZ_CP033744.1 | Citrobacter freundii |
| 10 | 474009 | 474224 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 11 | 2592570 | 2592782 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 12 | 1695310 | 1695522 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 13 | 1071015 | 1071230 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 14 | 2018987 | 2019208 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 15 | 1043246 | 1043467 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 16 | 1961728 | 1961949 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 17 | 4189299 | 4189520 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 18 | 911444 | 911665 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 19 | 4525390 | 4525596 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 20 | 2974475 | 2974690 | + | NZ_CP053416.1 | Salmonella bongori |
| 21 | 2716536 | 2716751 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 22 | 2588352 | 2588558 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 23 | 1009932 | 1010162 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 24 | 958604 | 958840 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 25 | 1550570 | 1550806 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 26 | 1199483 | 1199719 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 27 | 3781216 | 3781434 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 28 | 433303 | 433518 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 29 | 3606041 | 3606259 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 30 | 3578014 | 3578208 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 31 | 1038567 | 1038803 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 32 | 955478 | 955714 | + | NC_015968.1 | Enterobacter soli |
| 33 | 3605644 | 3605862 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 34 | 4374721 | 4374957 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 35 | 3512699 | 3512935 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 36 | 1043170 | 1043385 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 37 | 1052758 | 1052973 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 38 | 2392754 | 2392969 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 39 | 2991595 | 2991810 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 40 | 1044333 | 1044548 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 41 | 2141881 | 2142090 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 42 | 3099995 | 3100210 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 43 | 2863756 | 2863965 | + | NZ_CP026047.1 | Raoultella planticola |
| 44 | 4381124 | 4381333 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 45 | 4091594 | 4091797 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 46 | 4076144 | 4076347 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 47 | 4359415 | 4359618 | - | NZ_CP054254.1 | Klebsiella variicola |
| 48 | 4482739 | 4482942 | - | NZ_CP050508.1 | Raoultella terrigena |
| 49 | 4150716 | 4150922 | - | NZ_CP041247.1 | Raoultella electrica |
| 50 | 3869198 | 3869368 | - | NZ_CP023525.1 | Cedecea neteri |
| 51 | 1119334 | 1119537 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 52 | 3541645 | 3541821 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 53 | 3558785 | 3558955 | - | NZ_LR134201.1 | Cedecea lapagei |
| 54 | 4704921 | 4705124 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 55 | 4785131 | 4785334 | - | NZ_CP060111.1 | Klebsiella michiganensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP016337.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00144.26 | 0.93 | 50 | 3733 | opposite-strand | Beta-lactamase |
| 2 | PF05992.14 | 0.94 | 51 | 1697.0 | same-strand | SbmA/BacA-like family |
| 3 | PF07759.14 | 1.0 | 54 | 572 | same-strand | Protein of unknown function (DUF1615) |
| 4 | PF10954.10 | 1.0 | 54 | 259 | opposite-strand | Protein of unknown function (DUF2755) |
| 5 | PF07478.15 | 1.0 | 54 | 24 | opposite-strand | D-ala D-ala ligase C-terminus |
| 6 | PF01820.23 | 1.0 | 54 | 24 | opposite-strand | D-ala D-ala ligase N-terminus |
| 7 | PF02222.24 | 1.0 | 54 | 24 | opposite-strand | ATP-grasp domain |
| 8 | PF10796.11 | 0.81 | 44 | 3500 | same-strand | Sigma-S stabilisation anti-adaptor protein |
| 9 | PF02786.19 | 0.94 | 51 | 11 | opposite-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 10 | PF12832.9 | 0.74 | 40 | 2053.5 | same-strand | MFS 1 like family |
| 11 | PF06904.14 | 0.63 | 34 | 1228.0 | same-strand | Extensin-like protein C-terminus |
| 12 | PF00857.22 | 0.63 | 34 | 3025.0 | same-strand | Isochorismatase family |
++ More..