Result : P0AAA6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YmcE |
| NCBI Accession ID | |
| Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MRRWISQNNIRLPRGAFFISALFFFNAVCIVSDNLLIIESFGEMAYNISYLTRVPGTNTLLACCCLLRPEEVNSEY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl27789. Profile Description: Putative antitoxin of bacterial toxin-antitoxin system. YmcE_antitoxin is the putative antitoxin for the supposed bacterial toxin GnsA, UniProtKB:P0AC92, family pfam08178. |
| Pubmed ID | 12471157 |
| Domain | CDD:332610 |
| Functional Category | Others |
| Uniprot ID | P0AAA6 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1051847 | 1052077 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1039482 | 1039712 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 1230343 | 1230573 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 1062724 | 1062987 | + | NZ_AP014857.1 | Escherichia albertii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004337.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF11102.10 | 1.0 | 3 | 1738.0 | opposite-strand | Group 4 capsule polysaccharide lipoprotein gfcB, YjbF |
| 2 | PF00313.24 | 1.0 | 3 | 174 | same-strand | 'Cold-shock' DNA-binding domain |
| 3 | PF08178.13 | 1.0 | 3 | -10 | same-strand | GnsA/GnsB toxin of bacterial toxin-antitoxin system |
| 4 | PF12801.9 | 1.0 | 3 | 212.0 | opposite-strand | 4Fe-4S binding domain |
| 5 | PF13187.8 | 1.0 | 3 | 212.0 | opposite-strand | 4Fe-4S dicluster domain |
| 6 | PF12838.9 | 1.0 | 3 | 212.0 | opposite-strand | 4Fe-4S dicluster domain |
| 7 | PF14697.8 | 1.0 | 3 | 212.0 | opposite-strand | 4Fe-4S dicluster domain |
| 8 | PF12837.9 | 1.0 | 3 | 212.0 | opposite-strand | 4Fe-4S binding domain |
| 9 | PF13237.8 | 1.0 | 3 | 212.0 | opposite-strand | 4Fe-4S dicluster domain |
| 10 | PF02518.28 | 1.0 | 3 | 1357.0 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 11 | PF00512.27 | 1.0 | 3 | 1357.0 | opposite-strand | His Kinase A (phospho-acceptor) domain |
| 12 | PF00072.26 | 1.0 | 3 | 1387 | opposite-strand | Response regulator receiver domain |
| 13 | PF01627.25 | 1.0 | 3 | 1357.0 | opposite-strand | Hpt domain |
| 14 | PF00672.27 | 1.0 | 3 | 1357.0 | opposite-strand | HAMP domain |
| 15 | PF00532.23 | 1.0 | 3 | 4183.5 | same-strand | Periplasmic binding proteins and sugar binding domain of LacI family |
| 16 | PF13407.8 | 1.0 | 3 | 4183.5 | same-strand | Periplasmic binding protein domain |
| 17 | PF00486.30 | 0.67 | 2 | 5184 | opposite-strand | Transcriptional regulatory protein, C terminal |
| 18 | PF06082.13 | 0.67 | 2 | 3125.0 | opposite-strand | Exopolysaccharide biosynthesis protein YbjH |
| 19 | PF06251.13 | 1.0 | 3 | 2379 | opposite-strand | Capsule biosynthesis GfcC |
++ More..