Result : A4SD66
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0235 protein Cvib_0403 |
| NCBI Accession ID | CP000607.1 |
| Organism | Chlorobium phaeovibrioides (strain DSM 265 / 1930) (Prosthecochloris vibrioformis (strain DSM 265)) |
| Left | 413340 |
| Right | 413642 |
| Strand | + |
| Nucleotide Sequence | ATGCGGGTGGTTGCCGTTCGTGAAAAAAAGGGGAATGCTCTCTTTTCGGTAAGGGTGCAGCCCCGGGCTTCCAAAACCGCTGTTTCCGGTCCCTATGCGGGCGGGTTGAAAATAACCCTGAAGGCTGCGCCTGTAGATGATGCTGCCAATAGAGAGTGCTGCCGGCTGTTTGCCGGCATGTTCGGGATTGCCGACGGCCGTGTTCATGTTGTTTCGGGCCGCAGTTCGCGGAGCAAGTCGGTGATGCTTGAGGGGGTGAGTTCCCGTGAGGCGGAAGAGGCCTTTGAGAGGTTTGGTTTGTAA |
| Sequence | MRVVAVREKKGNALFSVRVQPRASKTAVSGPYAGGLKITLKAAPVDDAANRECCRLFAGMFGIADGRVHVVSGRSSRSKSVMLEGVSSREAEEAFERFGL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated |
| Pubmed ID | |
| Domain | CDD:412584 |
| Functional Category | Others |
| Uniprot ID | A4SD66 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 347838 | 348143 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 2 | 2498604 | 2498897 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 3 | 2414868 | 2415158 | - | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 4 | 2250789 | 2251094 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
| 5 | 1736443 | 1736712 | - | NC_002932.3 | Chlorobaculum tepidum TLS |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008639.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00403.28 | 1.0 | 5 | 3840 | same-strand | Heavy-metal-associated domain |
| 2 | PF01936.20 | 0.8 | 4 | 3103.5 | same-strand | NYN domain |
| 3 | PF12872.9 | 0.8 | 4 | 3103.5 | same-strand | OST-HTH/LOTUS domain |
| 4 | PF00285.23 | 1.0 | 5 | 364 | same-strand | Citrate synthase, C-terminal domain |
| 5 | PF02686.17 | 1.0 | 5 | 12 | same-strand | Glu-tRNAGln amidotransferase C subunit |
| 6 | PF02348.21 | 1.0 | 5 | 446 | same-strand | Cytidylyltransferase |
| 7 | PF13742.8 | 1.0 | 5 | 1173 | opposite-strand | OB-fold nucleic acid binding domain |
| 8 | PF01336.27 | 1.0 | 5 | 1173 | opposite-strand | OB-fold nucleic acid binding domain |
| 9 | PF05036.15 | 0.8 | 4 | 2498.0 | same-strand | SPOR domain |
| 10 | PF00148.21 | 0.8 | 4 | 3378.0 | same-strand | Nitrogenase component 1 type Oxidoreductase |
| 11 | PF00691.22 | 0.6 | 3 | 2109 | same-strand | OmpA family |
| 12 | PF02580.18 | 0.6 | 3 | 3 | same-strand | D-Tyr-tRNA(Tyr) deacylase |
++ More..