Result : P0A9R3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Lysis protein S homolog from lambdoid prophage DLP12 |
| NCBI Accession ID | AE014075.1 |
| Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Left | 1421678 |
| Right | 1421893 |
| Strand | + |
| Nucleotide Sequence | ATGAAATCCATGGATAAGTTAACAACGGGTGTCGCCTATGGTACCTCAGCAGGTAGTGCCGGGTACTGGTTTTTACAGTTGCTCGATAAAGTCACGCCCTCACAGTGGGCGGCAATAGGTGTGCTGGGTAGCCTGGTATTTGGCCTGCTGACGTACCTGACAAACCTTTATTTCAAGATTAAAGAAGATAAGCGCAAGGCTGCGAGAGGTGAATAA |
| Sequence | MKSMDKLTTGVAYGTSAGSAGYWFLQLLDKVTPSQWAAIGVLGSLVFGLLTYLTNLYFKIKEDKRKAARGE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl04868. Profile Description: Bacteriophage P21 holin S. Phage_holin_2_4 is a family of small hydrophobic phage proteins called holins with one transmembrane domain. Holins are produced by double-stranded DNA bacteriophages that use an endolysin-holin strategy to achieve lysis of their hosts. The endolysins are peptidoglycan-degrading enzymes that are usually accumulated in the cytosol until access to the cell wall substrate is provided by the holin membrane lesion. |
| Pubmed ID | 12471157 |
| Domain | CDD:414213 |
| Functional Category | Others |
| Uniprot ID | P0A9R3 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 23
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 577398 | 577613 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1640370 | 1640585 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1857354 | 1857569 | + | NZ_LR134340.1 | Escherichia marmotae |
| 4 | 2327749 | 2327964 | - | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 1763665 | 1763880 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 3994218 | 3994433 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 2060413 | 2060628 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 8 | 721468 | 721683 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 9 | 1575822 | 1576001 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 10 | 1338536 | 1338751 | + | NZ_AP014857.1 | Escherichia albertii |
| 11 | 4247979 | 4248194 | + | NZ_AP014857.1 | Escherichia albertii |
| 12 | 2132509 | 2132724 | - | NZ_AP014857.1 | Escherichia albertii |
| 13 | 2002763 | 2002978 | - | NZ_AP014857.1 | Escherichia albertii |
| 14 | 3217527 | 3217742 | - | NZ_CP041247.1 | Raoultella electrica |
| 15 | 3342073 | 3342288 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 16 | 3389863 | 3390078 | - | NZ_CP054254.1 | Klebsiella variicola |
| 17 | 3150443 | 3150658 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 18 | 1679675 | 1679890 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 19 | 2275997 | 2276212 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 20 | 2319717 | 2319932 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 21 | 1791967 | 1792182 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 22 | 2921272 | 2921487 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 23 | 1272789 | 1273004 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 24 | 901807 | 902022 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 25 | 1776838 | 1777053 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 26 | 3484020 | 3484235 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 27 | 2237030 | 2237215 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 28 | 2186068 | 2186253 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 29 | 1557898 | 1558113 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 30 | 2693142 | 2693327 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 31 | 1944136 | 1944351 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 32 | 1186169 | 1186354 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 33 | 2688094 | 2688309 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 34 | 1028261 | 1028476 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 35 | 2712649 | 2712864 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 36 | 1133664 | 1133879 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 37 | 2730024 | 2730239 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 38 | 3787681 | 3787887 | + | NZ_CP007230.1 | Yersinia similis |
| 39 | 2113529 | 2113744 | - | NZ_LR134201.1 | Cedecea lapagei |
| 40 | 1862153 | 1862380 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 41 | 1281726 | 1281944 | + | NZ_CP031123.2 | Providencia huaxiensis |
| 42 | 1898834 | 1899052 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 43 | 1712739 | 1712963 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 44 | 1553440 | 1553664 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 45 | 2447334 | 2447558 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 46 | 2722187 | 2722408 | - | NZ_LS483422.1 | Providencia heimbachae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00959.21 | 1.0 | 23 | 0 | same-strand | Phage lysozyme |
++ More..