Result : P0A9I6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Chaperone NapD (NapA signal peptide-binding chaperone NapD) |
| NCBI Accession ID | AE005174.2 |
| Organism | Escherichia coli O157:H7 |
| Left | 3107572 |
| Right | 3107835 |
| Strand | - |
| Nucleotide Sequence | ATGCACACTAACTGGCAAGTTTGCAGCCTGGTTGTGCAGGCCAAAAGCGAACGAATTTCAGACATCAGCACCCAACTGAACGCCTTTCCCGGCTGTGAAGTTGCTGTCAGCGACGCGCCGAGCGGTCAGTTGATTGTGGTGGTGGAAGCAGAAGACAGCGAAACGCTGATCCAAACCATTGAGTCAGTACGCAACGTAGAGGGCGTGCTGGCGGTGTCGCTGGTTTATCACCAGCAGGAAGAGCAAGGTGAGGAAACACCATGA |
| Sequence | MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETP |
| Source of smORF | Swiss-Prot |
| Function | Chaperone for NapA, the catalytic subunit of the periplasmic nitrate reductase. It binds directly and specifically to the twin-arginine signal peptide of NapA, preventing premature interaction with the Tat translocase and premature export. {ECO:0000255|HAMAP-Rule:MF_02200}. |
| Pubmed ID | 11206551 11258796 |
| Domain | CDD:412773 |
| Functional Category | Others |
| Uniprot ID | P0A9I6 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 53
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1297984 | 1298247 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 2 | 2324750 | 2325013 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 2302750 | 2303013 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 3036438 | 3036701 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 2845232 | 2845495 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 2793183 | 2793446 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 7 | 2310559 | 2310822 | - | NZ_AP014857.1 | Escherichia albertii |
| 8 | 2304675 | 2304938 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 9 | 4541257 | 4541520 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 10 | 553793 | 554059 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 11 | 4047441 | 4047704 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 12 | 1021521 | 1021784 | - | NZ_CP033744.1 | Citrobacter freundii |
| 13 | 228994 | 229257 | + | NZ_CP038469.1 | Citrobacter tructae |
| 14 | 2358900 | 2359163 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 15 | 2453982 | 2454245 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 16 | 339653 | 339916 | - | NZ_CP053416.1 | Salmonella bongori |
| 17 | 1293142 | 1293420 | + | NZ_CP048796.1 | Providencia vermicola |
| 18 | 1165859 | 1166122 | + | NZ_LR134201.1 | Cedecea lapagei |
| 19 | 2218037 | 2218300 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 20 | 2095080 | 2095343 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 21 | 2530269 | 2530547 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 22 | 1194174 | 1194437 | + | NZ_CP023525.1 | Cedecea neteri |
| 23 | 1325794 | 1326072 | + | NZ_LS483422.1 | Providencia heimbachae |
| 24 | 1232918 | 1233181 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 25 | 4926375 | 4926620 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 26 | 3769134 | 3769412 | - | NZ_CP029736.1 | Providencia rettgeri |
| 27 | 2510144 | 2510356 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 28 | 563854 | 564087 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 29 | 1360745 | 1361008 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 30 | 1156803 | 1157033 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 31 | 3322716 | 3322979 | - | NZ_CP032487.1 | Yersinia hibernica |
| 32 | 4347521 | 4347751 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 33 | 3978422 | 3978652 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 34 | 1538815 | 1539048 | - | NZ_CP009787.1 | Yersinia rohdei |
| 35 | 3367673 | 3367906 | - | NZ_CP046293.1 | Yersinia intermedia |
| 36 | 1328175 | 1328411 | + | NZ_CP043727.1 | Yersinia canariae |
| 37 | 3198303 | 3198539 | - | NZ_CP050150.1 | Hafnia alvei |
| 38 | 1333318 | 1333551 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 39 | 2879351 | 2879587 | - | NZ_LR134531.1 | Pragia fontium |
| 40 | 1027719 | 1028000 | + | NZ_LS483470.1 | Leminorella richardii |
| 41 | 1400154 | 1400387 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 42 | 4865701 | 4865934 | - | NZ_CP007230.1 | Yersinia similis |
| 43 | 4164570 | 4164833 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 44 | 1212646 | 1212879 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 45 | 3832275 | 3832511 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 46 | 2915060 | 2915323 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 47 | 3078738 | 3078971 | + | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 48 | 1062428 | 1062664 | + | NZ_CP029185.2 | Limnobaculum parvum |
| 49 | 3924689 | 3924952 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 50 | 2564874 | 2565137 | + | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 51 | 2958037 | 2958306 | + | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 52 | 88780 | 89043 | - | NZ_CP065640.1 | Serratia rubidaea |
| 53 | 3812378 | 3812641 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 54 | 3876776 | 3877039 | - | NZ_LR134494.1 | Serratia quinivorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP057657.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03264.16 | 0.98 | 52 | 4491 | same-strand | NapC/NirT cytochrome c family, N-terminal region |
| 2 | PF03892.16 | 0.91 | 48 | 4032 | same-strand | Nitrate reductase cytochrome c-type subunit (NapB) |
| 3 | PF12801.9 | 0.7 | 37 | 3172.0 | same-strand | 4Fe-4S binding domain |
| 4 | PF13187.8 | 0.98 | 52 | 27 | same-strand | 4Fe-4S dicluster domain |
| 5 | PF13237.8 | 0.92 | 49 | 2996.0 | same-strand | 4Fe-4S dicluster domain |
| 6 | PF14697.8 | 0.96 | 51 | 27 | same-strand | 4Fe-4S dicluster domain |
| 7 | PF12838.9 | 0.98 | 52 | 33 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF12797.9 | 0.72 | 38 | 23.0 | same-strand | 4Fe-4S binding domain |
| 9 | PF00384.24 | 1.0 | 53 | -3.0 | same-strand | Molybdopterin oxidoreductase |
| 10 | PF01568.23 | 1.0 | 53 | -3.0 | same-strand | Molydopterin dinucleotide binding domain |
| 11 | PF04879.18 | 1.0 | 53 | -3.0 | same-strand | Molybdopterin oxidoreductase Fe4S4 domain |
| 12 | PF10518.11 | 0.92 | 49 | -3.0 | same-strand | TAT (twin-arginine translocation) pathway signal sequence |
| 13 | PF00037.29 | 0.7 | 37 | -10.0 | same-strand | 4Fe-4S binding domain |
++ More..