Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein Mb2896 |
NCBI Accession ID | LT708304.1 |
Organism | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
Left | 3144066 |
Right | 3144323 |
Strand | + |
Nucleotide Sequence | GTGCGCACGACGATCCGTATCGATGACGAGCTGTACCGCGAGGTGAAAGCAAAGGCCGCTCGTTCCGGGCGTACCGTGGCCGCGGTTCTTGAAGATGCGGTGCGGCGTGGTCTCAACCCGCCTAAGCCGCAGGCCGCCGGCCGTTATCGAGTCCAGCCGTCGGGTAAGGGCGGCCTGCGGCCCGGTGTCGATCTATCGTCCAACGCCGCACTTGCCGAAGCGATGAACGACGGCGTGTCGGTCGATGCTGTGCGTTGA |
Sequence | MRTTIRIDDELYREVKAKAARSGRTVAAVLEDAVRRGLNPPKPQAAGRYRVQPSGKGGLRPGVDLSSNAALAEAMNDGVSVDAVR |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl22901. Profile Description: Ribbon-helix-helix protein, copG family. ParD is the antitoxin of a bacterial toxin-antitoxin gene pair. The cognate toxin is ParE in, pfam05016. The family contains several related antitoxins from Cyanobacteria, Proteobacteria and Actinobacteria. Antitoxins of this class carry an N-terminal ribbon-helix-helix domain, RHH, that is highly conserved across all type II bacterial antitoxins, which dimerizes with the RHH domain of a second VapB molecule. A hinge section follows the RHH, with an additional pair of flexible alpha helices at the C-terminus. This C-terminus is the toxin-binding region of the dimer, and so is specific to the cognate toxin, whereas the RHH domain has the specific function of lying across the RNA-binding groove of the toxin dimer and inactivating the active-site - a more general function of all type II antitoxins. |
Pubmed ID | 12788972 28385856 |
Domain | CDD:419885 |
Functional Category | Antitoxin_type_2 |
Uniprot ID | P0A5H0 |
ORF Length (Amino Acid) | 85 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3183138 | 3183395 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
2 | 3241773 | 3242030 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
3 | 5415729 | 5415986 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
4 | 1437269 | 1437526 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
5 | 3660859 | 3661116 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
6 | 1336781 | 1337038 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
7 | 5204473 | 5204715 | + | NZ_LR134355.1 | Mycolicibacterium chitae |
8 | 3267809 | 3268048 | + | NC_014151.1 | Cellulomonas flavigena DSM 20109 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01850.23 | 0.88 | 7 | -13 | same-strand | PIN domain |